KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5036: BAM5036_1799Help
Entry
BAM5036_1799      CDS       T02480                                 

Gene name
proJ
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
baml  Bacillus amyloliquefaciens subsp. plantarum UCMB5036
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:baml00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAM5036_1799 (proJ)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BAM5036_1799 (proJ)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BAM5036_1799 (proJ)
Enzymes [BR:baml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BAM5036_1799 (proJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1987520..1988638)
Genome map
AA seq 372 aa AA seqDB search
MTSRTKIKRVAVKIGSSSLTSLHGEISRRKLEALVDQIAQLKDSGYEVILISSGAVAAGY
RKLGFIQKPEGLPEKQASASIGQGLLMEAYSKLFLAHGYVASQILITRSDFSDEYRYHNV
RNTMNVLLERGIIPIINENDTVTVNRLKFGDNDTLAAKVAGLIDADMLVILSDIDGLYDD
NPRSNPKAKRIRHVSDITPEIEASAGDAGSEMGTGGMRSKLDAFKIVMASGIKGFLGQAN
IPDILLQAVDEAAEGTYFEAEGTLPLNHKEQWLAFNSGPEGEIVMEKKSSRDVANGNMAL
SPQDIEQIKGRFSSGAVVRLLDQQGEELGLGIVNYSSAQLKTFKETPHKQTDQSVIDPEA
FVCHVELSIPIG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtctcggacgaagatcaaaagagtcgcggtgaaaatcggaagcagctcactgacg
agcctgcacggggaaatcagcagaagaaagctggaagcattggtggatcaaatcgcacag
ctgaaagacagcggctatgaagtgattttaatatcttccggcgcagtggcggcaggttat
cggaagctcggatttattcagaaaccggaaggcctccctgaaaaacaggcttctgcttcc
atcgggcagggattattaatggaggcttattcaaagctgtttttagcgcacggttatgtc
gcatcacaaatattaattacaagaagcgacttttccgatgaataccgctaccataatgtg
cgcaatacgatgaacgtccttttggaacgaggcattattccgattattaatgaaaatgac
acggtcacagtcaaccggctgaaattcggagataacgatacactcgcagcgaaggtggca
ggtttaattgatgccgacatgcttgtaattttatcagacattgacggtttatatgatgat
aatccgcgcagcaacccgaaagcgaaaagaatcagacatgtaagtgacatcactccggaa
atagaagcaagcgcgggagatgccgggagtgaaatgggaaccggcggaatgcgttcgaaa
ctggatgcttttaaaattgtgatggcctccggtattaaaggctttctcgggcaggctaac
attccggacattctgcttcaagcggtagatgaggcggctgaaggaacttattttgaagcg
gaaggaaccctgccgttaaaccacaaagaacaatggcttgcatttaattccggccccgaa
ggcgaaattgtgatggaaaagaaaagcagccgcgatgtcgcgaacggaaatatggcgctg
tcaccgcaggatatcgaacagattaagggcagattcagcagcggagcggttgtcaggctg
cttgatcagcagggagaagagctcggactcggcatcgtcaactattcctcagcccagctg
aagacatttaaagaaacgccgcacaaacagaccgatcaatcagtcattgatccggaagcg
tttgtctgccacgttgaactatccattccgatcggctga

DBGET integrated database retrieval system