KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5036: BAM5036_1799Help
Entry
BAM5036_1799      CDS       T02480                                 

Gene name
proJ
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
baml  Bacillus amyloliquefaciens subsp. plantarum UCMB5036
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:baml00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAM5036_1799 (proJ)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BAM5036_1799 (proJ)
Enzymes [BR:baml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BAM5036_1799 (proJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1987520..1988638)
Genome map
AA seq 372 aa AA seqDB search
MTSRTKIKRVAVKIGSSSLTSLHGEISRRKLEALVDQIAQLKDSGYEVILISSGAVAAGY
RKLGFIQKPEGLPEKQASASIGQGLLMEAYSKLFLAHGYVASQILITRSDFSDEYRYHNV
RNTMNVLLERGIIPIINENDTVTVNRLKFGDNDTLAAKVAGLIDADMLVILSDIDGLYDD
NPRSNPKAKRIRHVSDITPEIEASAGDAGSEMGTGGMRSKLDAFKIVMASGIKGFLGQAN
IPDILLQAVDEAAEGTYFEAEGTLPLNHKEQWLAFNSGPEGEIVMEKKSSRDVANGNMAL
SPQDIEQIKGRFSSGAVVRLLDQQGEELGLGIVNYSSAQLKTFKETPHKQTDQSVIDPEA
FVCHVELSIPIG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtctcggacgaagatcaaaagagtcgcggtgaaaatcggaagcagctcactgacg
agcctgcacggggaaatcagcagaagaaagctggaagcattggtggatcaaatcgcacag
ctgaaagacagcggctatgaagtgattttaatatcttccggcgcagtggcggcaggttat
cggaagctcggatttattcagaaaccggaaggcctccctgaaaaacaggcttctgcttcc
atcgggcagggattattaatggaggcttattcaaagctgtttttagcgcacggttatgtc
gcatcacaaatattaattacaagaagcgacttttccgatgaataccgctaccataatgtg
cgcaatacgatgaacgtccttttggaacgaggcattattccgattattaatgaaaatgac
acggtcacagtcaaccggctgaaattcggagataacgatacactcgcagcgaaggtggca
ggtttaattgatgccgacatgcttgtaattttatcagacattgacggtttatatgatgat
aatccgcgcagcaacccgaaagcgaaaagaatcagacatgtaagtgacatcactccggaa
atagaagcaagcgcgggagatgccgggagtgaaatgggaaccggcggaatgcgttcgaaa
ctggatgcttttaaaattgtgatggcctccggtattaaaggctttctcgggcaggctaac
attccggacattctgcttcaagcggtagatgaggcggctgaaggaacttattttgaagcg
gaaggaaccctgccgttaaaccacaaagaacaatggcttgcatttaattccggccccgaa
ggcgaaattgtgatggaaaagaaaagcagccgcgatgtcgcgaacggaaatatggcgctg
tcaccgcaggatatcgaacagattaagggcagattcagcagcggagcggttgtcaggctg
cttgatcagcagggagaagagctcggactcggcatcgtcaactattcctcagcccagctg
aagacatttaaagaaacgccgcacaaacagaccgatcaatcagtcattgatccggaagcg
tttgtctgccacgttgaactatccattccgatcggctga

DBGET integrated database retrieval system