KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5036: BAM5036_1867Help
Entry
BAM5036_1867      CDS       T02480                                 

Definition
Glucan endo-1,6-beta-glucosidase (EC:3.2.1.75)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
baml  Bacillus amyloliquefaciens subsp. plantarum UCMB5036
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baml00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BAM5036_1867
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BAM5036_1867
Enzymes [BR:baml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BAM5036_1867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2049278..2050756)
Genome map
AA seq 492 aa AA seqDB search
MFLKKGLHMTLVFLMFFFFISSSTETEVYAADRKASDKNKVRVWFSSEKDPASRTWYDGP
LEVKYALDEQTPLTWTKKKASDSAAVYIDPSRRYQSVLGVGSSLEESTIHNLSKMTPAKR
KEVLKKLVDPKDGIGMDVMRITIGTSDFTAQEFYTYDDMPEGQTDPKLHHFSIQKDIDLH
ITATIKEALAINPELKIIASPWSPPAWMKTNENLKRGKLKDKYIGALAVYFRKFIEAYEK
QGIPIYAMTLQNEPLLEIDYPSMYMPPSQQRKLALALKKEMKKHIIDTKIWIYDHNASGA
WNYIPPILDDKKGNRAADGIAFHDYDGDLSVMSEIGKRYPDQSIHLTERSVWGTAGADRI
AQYFRNGASSYNAWVTMLDSQIKTHHWIGTPDPTLFIQDAKNPDRYWNIPIFHMTGNFSK
FIDRGAKRIESNYGSKNTVSNVSFLNPDQSVVTVVINQTSADQKFHVVSENRQFEAVIPA
KTVATYKWKWKK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgaaaaaaggtctgcacatgaccctggtttttcttatgtttttctttttcata
tcaagcagcacggaaaccgaagtgtatgcggctgatcggaaggcttcagacaaaaacaaa
gtaagggtgtggttcagttctgaaaaagatccggcttcccgtacgtggtatgacgggccg
ctggaagtgaaatacgccttagacgaacaaacaccgcttacatggacaaaaaagaaggct
tctgactccgccgccgtgtatattgatccgtcgcgccgctatcaaagtgtgttaggcgta
ggatcgtccctggaagaatccacaatccataatttatcaaaaatgacacccgcaaaaaga
aaagaagtgctgaaaaaactggttgatcccaaagatggtatcggaatggacgttatgcgc
ataacgatcgggacatctgattttacggcacaggaattttatacgtatgacgatatgcct
gaaggccaaacagatcctaagctccatcatttctcgattcaaaaggatattgatttacac
attacagcaaccatcaaggaagcgctggcgataaatccggaactgaaaatcattgcctca
ccgtggagtccgccggcttggatgaaaacgaatgaaaacctcaagcggggaaagctgaaa
gataaatatatcggcgcactggccgtttacttccgcaaatttattgaggcgtacgaaaag
caaggaattccgatttatgccatgacccttcaaaatgaacctttgctggaaatcgactat
ccgagcatgtatatgccgccgtctcagcagcgcaaactggcactggccttaaaaaaagaa
atgaaaaaacacataattgacacgaaaatttggatttatgatcacaatgcgagcggggcg
tggaactatattccgccgattttagatgataaaaaaggaaaccgggcggcagacggcatc
gcttttcacgattatgacggtgacctttccgtcatgtcggaaatcggaaagagatatcct
gatcaatctattcacttaacggagcggtctgtctgggggacggcaggggcggaccggatc
gcgcagtatttccgcaacggcgcgtcgagctacaatgcgtgggtgacgatgctcgacagt
caaatcaagacgcatcattggataggcaccccagacccgacgctgtttattcaggatgct
aaaaaccctgaccgctattggaatatcccgatctttcatatgacaggcaacttttcaaaa
tttatcgaccggggagcaaagcggatagaaagtaattacggctccaaaaacacagtctcg
aatgtatcgttccttaatcctgatcaatccgttgtgacagtcgtaatcaaccagacatcc
gccgatcagaaattccatgtcgtttcagaaaatcggcagtttgaagccgtcatcccggct
aaaaccgtagctacctacaaatggaagtggaaaaagtaa

DBGET integrated database retrieval system