KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5036: BAM5036_2021Help
Entry
BAM5036_2021      CDS       T02480                                 

Gene name
folEA
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
baml  Bacillus amyloliquefaciens subsp. plantarum UCMB5036
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:baml00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2183617..2184189)
Genome map
AA seq 190 aa AA seqDB search
MKEVNKEQIEQAVRQILEAIGEDPDREGLLDTPKRVAKMYAEVFSGLNEDPKEHFKTVFG
EDHEELVLVKDIAFHSMCEHHLVPFYGKAHIAYIPRGGKVTGLSKLARAVEAVSKRPQLQ
ERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGIFKDDAAARS
EVLEHIKRAD
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttaataaagaacagattgaacaggcggttcgccagattttagaggcgatt
ggagaagacccggaccgggaagggcttttagatacgccgaaacgcgtggcgaaaatgtac
gcggaagtattctcgggattaaatgaagacccgaaagaacactttaaaaccgttttcgga
gaagaccatgaggagcttgttcttgtaaaagatatcgcgtttcattccatgtgtgaacat
caccttgttcctttttacggaaaagcgcatattgcctacattccgcgcggcggcaaagtg
acgggcctgagtaaattggcgcgggcggtggaagccgtctcaaaacgcccgcagctgcag
gagcgcatcacttcaacgattgcagaaagcatcgtagagaccttagatccccatggcgtc
atggttgtcgtcgaggctgagcatatgtgcatgacaatgaggggcgtaagaaagccaggt
gcaaaaacagtgacttccgctgtaagaggtatttttaaagatgacgcagcggcgcgttcc
gaagtgttagaacatattaaacgtgcggattaa

DBGET integrated database retrieval system