KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5036: BAM5036_2461Help
Entry
BAM5036_2461      CDS       T02480                                 

Gene name
hemD
Definition
uroporphyrinogen III cosynthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
baml  Bacillus amyloliquefaciens subsp. plantarum UCMB5036
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:baml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BAM5036_2461 (hemD)
Enzymes [BR:baml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BAM5036_2461 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2643229..2644008)
Genome map
AA seq 259 aa AA seqDB search
MANDLPLQGKTVLVTRNKRQAAPFRKKVEALGGTAVSASLIAFQEALPDECADSLREDLS
EPGWLVFTSVNGVRFFFSYLDRHGLALSGRKKIATVGEKTARALKERGARTDAMPDEYVA
ECLADTLKRHASAAEPISVIKGNLSRDVIKAELEPLGYQIREWVLYNTIQDEKGMDELRR
AASRSHFDFITFTSSSAVHTFMHAVGDGEKAWENSGASYISIGPLTEKALLEYGISSHVP
DTYTIEGMLDVMCSMSGKD
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgaccttcctttacaaggaaagaccgtgcttgtcacccggaacaaaagacag
gccgcaccgttccgaaaaaaagtggaagcgctcggcggaacggctgtttccgcttcgctg
atcgcttttcaggaagcgctcccggatgaatgtgcggacagtctgcgggaagacctttct
gagccgggatggcttgtgtttacaagcgtaaacggtgtccggttctttttttcctatctt
gatcgtcacggtcttgcgctatcgggacggaaaaaaatcgcaaccgtcggtgaaaagact
gcgcgcgccctgaaagagcggggagcccggacggatgcgatgcctgacgagtatgtggcg
gaatgtctggctgatactttaaaacggcacgcatcagctgccgaacccatttcagtgata
aagggcaatttatcacgcgatgtcataaaagcggagcttgagccgcttggctatcaaata
agggaatgggtgttatacaataccattcaggatgaaaaaggcatggacgagctgagacgg
gctgcatcccgctctcattttgattttattacgtttaccagctcatcggcggtccatacg
tttatgcacgcggtcggagacggagaaaaagcgtgggaaaacagcggtgcgagctatatc
agcatcggccctttgacagagaaagcgctcttggaatacgggatctcatcccatgtgcct
gacacttatacgattgaaggcatgctggacgtcatgtgcagtatgtcgggaaaggattga

DBGET integrated database retrieval system