KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5036: BAM5036_3005Help
Entry
BAM5036_3005      CDS       T02480                                 

Gene name
yvaK
Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
baml  Bacillus amyloliquefaciens subsp. plantarum UCMB5036
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3187014..3187754)
Genome map
AA seq 246 aa AA seqDB search
MKIVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYKGHGVPPEEL
VHTGPEDWWKDVMDGYEYLRSEGYENIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMHI
KSEKVMYEGVLSYARNYKKFEGKQPEQIEKEMKEFEKTPMNTLKSLQELIADVRKNVDMI
YSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVYEF
LEKLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtgcttctg
ctgcacggatttacgggaaatacggcagacgtcagaatgctcggccgctacttgaatgag
cgcggctacacttgtcacgcgcctcaatataaagggcacggcgttccgccggaagaactg
gtacatacggggcctgaagattggtggaaagacgtcatggacggttatgagtatttacgg
tctgaaggctatgaaaacattgcggcctgcggactgtcgcttggcggggttttttcattg
aaattgggttacactgtacccataaagggaattgttcctatgtgtgcgccgatgcacatt
aaaagtgaaaaggttatgtacgaaggagttctttcctacgcgcgcaattataaaaaattc
gaaggaaaacagccggagcagattgaaaaggaaatgaaggagtttgaaaaaacaccgatg
aatacgctcaaatcgcttcaggagctgattgccgatgtgcgcaaaaacgtcgacatgatc
tattccccgacatttgtggttcaggcacggcatgaccatatgattaatacagaaagtgcg
aacatcatttacaacgaggtggaaacggacgacaaacagctgaaatggtatgaagaatca
ggccatgtcattacgctcgataaagaacgggacctcgttcatcaggatgtgtacgaattt
ttagagaaactcgattggtaa

DBGET integrated database retrieval system