KEGG   Bacillus velezensis UCMB5036: BAM5036_3431Help
Entry
BAM5036_3431      CDS       T02480                                 

Gene name
spsL
Definition
(GenBank) dTDP-4-deoxyrhamnose-3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
baml  Bacillus velezensis UCMB5036
Pathway
baml00521  Streptomycin biosynthesis
baml00523  Polyketide sugar unit biosynthesis
baml01130  Biosynthesis of antibiotics
Module
baml_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:baml00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BAM5036_3431 (spsL)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BAM5036_3431 (spsL)
Enzymes [BR:baml01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BAM5036_3431 (spsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_2
Motif
Other DBs
NCBI-ProteinID: CCP23437
Position
complement(3603764..3604219)
Genome map
AA seq 151 aa AA seqDB search
MIEGVKIKKLIKHSDDRGFFSELVRDDEHLLERFGQASWSKSYPGVIKAFHYHEKQDDLW
FFPTGHAQVVLHDLREESATKGETDVYYMGEDNPMLLLIPKGVAHGYRVLGETPLTIIYF
TTMSYNPDQPDEKRIPWNDDTIGFDWQTAHR
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaaggcgtaaaaatcaaaaagctgatcaaacacagcgatgaccggggttttttc
tcagaactcgtccgtgacgatgaacatctcttagagcgtttcgggcaggcttcctggtcc
aaaagctatcccggcgtcattaaagcgtttcactatcatgagaaacaggatgacctatgg
ttttttccgacgggccacgcccaggtcgtgctgcatgaccttcgcgaagagtctgcaacc
aagggagaaacggatgtctactacatgggagaagacaatccgatgctccttctcattccc
aaaggcgtcgcacacgggtacagagtgctgggtgaaaccccgctgaccattatttatttc
acgacaatgtcctacaatccggatcagcctgacgaaaaaagaatcccgtggaatgatgac
accatcggatttgactggcagacggctcaccgatag

DBGET integrated database retrieval system