KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5113: BASU_0285Help
Entry
BASU_0285         CDS       T02796                                 

Gene name
amyE
Definition
AmyE alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bamn  Bacillus amyloliquefaciens subsp. plantarum UCMB5113
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bamn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
298541..300520
Genome map
AA seq 659 aa AA seqDB search
MFEKRFKTSLLPLFAGFLLLFHLVLSGPAAANAETANKSNKVTASSVKNGTILHAWNWSF
NTLTQNMKDIRDAGYAAIQTSPINQVKEGNQGDKSMRNWYWLYQPTSYQIGNRYLGTEQE
FKDMCAAAEKYGVKVIVDAVINHTTSDYGAISDEIKRIPNWTHGNTQIKNWSDRWDVTQN
SLLGLYDWNTQNTEVQVYLKRFLERALNDGADGFRYDAAKHIELPDDGNYGSQFWPNITN
ISAEFQYGEILQDSASRDTAYANYMNVTASNYGHSIRSALKNRNLSVSNISHYASDVSAD
KLVTWVESHDTYANDDEESTWMSDDDIRLGWAVIGSRSGSTPLFFSRPEGGGNGVRFPGK
SQIGDRGSALFKDQAITAVNQFHNVMAGQPEELSNPNGNNQIFMNQRGSKGVVLANAGSS
SVTINTSTKLPDGRYDNRAGAGSFQVTNGKLTGTINARSAAVLYPDDIGNAPHVFLENYQ
TGAVHSFNDQLTVTLRANAKITKAVYQINNGQQTAFKDGDRLTIGKGDPIGTTYNIKLTG
TNGEGAARTQEYTFVKKDPSQTNIIGYQNPDHWGQVNAYIYKHDGGRAIELTGSWPGKAM
TKNANGMYTLTLPENTDTANAKVIFNNGSAQVPGQNQPGFDYVQNGLYNNSGLNGYLPH
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaaacgattcaaaacctctttactgccgttattcgccggatttttattgctg
tttcatttggttttgtcaggcccggcggctgcaaacgctgaaactgcaaacaaatcgaat
aaggtgaccgcgtcatcggtcaaaaacgggaccatccttcatgcatggaattggtcgttt
aatacgttaacacaaaatatgaaagatattcgtgatgcgggctatgcagccattcagacg
tctccgattaaccaagtaaaggaagggaaccaaggagataaaagcatgaggaactggtac
tggctgtatcagccgacatcgtaccaaatcggcaaccgttacttaggcactgaacaagaa
tttaaggacatgtgtgcagccgcggaaaaatatggcgtaaaagtcattgtcgatgcggtt
atcaatcatactaccagcgattatggcgcgatttctgacgagattaagcgtattccaaac
tggacccatggaaacacacaaattaaaaattggtcggatcgatgggacgtcactcaaaat
tcattgcttgggctgtatgattggaatacacagaatactgaggtgcaggtctatctgaaa
cgtttcttggaaagagcattgaatgacggagcagacggattccgctatgatgccgccaag
catatagagcttccggatgatgggaattacggcagccaattttggccgaatatcacaaat
atatcggcagagttccaatacggagaaatcctgcaagacagcgcgtccagagatactgct
tatgcgaattatatgaatgtgacggcttctaactacgggcattccatcagatccgcttta
aagaaccgtaatctgagtgtgtcgaatatttcccattatgcatctgatgtgtctgcggac
aagttggtcacatgggtggaatcacatgatacgtatgccaatgatgacgaagagtccaca
tggatgagcgatgacgatattcgtttaggatgggcagtgattggttcccgttcaggaagt
acgcctcttttcttttccagacctgagggcggaggaaatggtgtaagatttcccggaaaa
agtcaaataggagatcgcgggagcgccttatttaaagatcaggcgatcactgcggtcaat
caatttcacaatgtaatggccgggcagcccgaggaactctcgaatccgaatgggaacaac
caaatctttatgaatcagcgcggctcaaaaggcgttgtgctggcaaatgcaggatcgtct
tctgtcaccatcaatacttcaacgaaattacctgacggcaggtatgataatagggccggc
gccggttcatttcaagtaacgaacggcaaactgacaggtacgatcaatgccagatccgcg
gctgttctttatcctgacgacattggaaatgcgcctcatgtctttcttgagaattaccaa
acgggggcagtccattctttcaatgatcagctgacggtcaccctgcgtgcaaatgcgaaa
ataacaaaagccgtttaccaaatcaataatgggcagcagacagcatttaaggatggagac
cgactaacgatcgggaaaggagatccaatcggcacgacttacaacatcaaattaaccgga
acgaacggcgagggtgcagcgagaacccaagaatacacgtttgttaaaaaagacccgtcc
caaaccaacatcattggctatcaaaatccggaccattggggccaggtaaatgcttatatc
tataaacatgatggaggcagggccatagaattaaccggatcgtggccggggaaagccatg
actaagaatgcaaatggaatgtacacgctgacgctgcctgagaatacggatacggccaat
gccaaagtgatttttaacaatggcagcgcccaagtgcccggacagaaccagcccggcttt
gattatgtgcagaatggtttgtataacaattctggtttgaatggttatcttccgcattaa

DBGET integrated database retrieval system