KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5113: BASU_0699Help
Entry
BASU_0699         CDS       T02796                                 

Gene name
cypD
Definition
putative bifunctional P-450/NADPH-P450 reductase 1 (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bamn  Bacillus amyloliquefaciens subsp. plantarum UCMB5113
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bamn00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BASU_0699 (cypD)
  Amino acid metabolism
   00380 Tryptophan metabolism
    BASU_0699 (cypD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BASU_0699 (cypD)
Enzymes [BR:bamn01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BASU_0699 (cypD)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BASU_0699 (cypD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
718114..721317
Genome map
AA seq 1067 aa AA seqDB search
MLERVLFMKETGPIPQPKTFGPLGNLPLLDKDKPTMSLIKLANEQGPIFQLHTPAGAIIV
VSGHELVKEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQRA
MKDYHSMMTDIAVQLIQKWARLNPDEAVDVPADMTRLTLDTIGLCGFNYRFNSYYRETPH
PFINSMVRALDEAMHQMQRLDVQDKLMIRTKRQFHHDIQAMFSLVDSIIAERRSGGRDEK
DLLARMLNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKHPRVLEKAY
EEADRVLTDPVPSYKQVLDLTYIRMILQESLRLWPTAPAFSLYAKEDTVIGGKYPITPKD
RISVLIPQLHRDKDAWGDNAEEFYPERFEHPDQVPHHAYKPFGNGQRACIGMQFALHEAT
LVLGMILQHFTFIDHTDYELDIKQTLTIKPGDFHIRVRPRNKEAVAAALPAAEKAAEDVE
KEKRETKGASIIGLDNRPLLILYGSDTGTAEGVARELADTAGMHGVRTETAPLNDRIGKL
PKEGALLIITSSYNGKPPSNAGQFVQWLEEVKPGELEGVRYAVFGCGDHNWAATYQAVPR
LIDEKLAEKGAERFSSRGEGDVSGDFEGKLDEWKKSMWTDAMKAFGLKLNENAEKERSAL
GLQFVSGLGGSPLAQTYEAVYASVAENRELQAPESGRSTRHIEITLPKEAAYHEGDHLGV
LPVNSKEQVSRVLRRFNLNGNDQVLLTASGQSAAHLPLDRPVRLHDLLSSCVELQEAASR
AQIREMAAYTVCPPHKRELEDFLEEGVYQEQILTSRVSMLDLLEKYEACELPFERFLELL
RPLKPRYYSISSSPRKHPGQASITVGVVRGPARSGLGEYRGVASNYLADRGPEDGIVMFV
RTPETRFRLPEDPEKPIIMVGPGTGVAPFRGFLQARAALKKEGKELGEAHLYFGCRNDHD
FIYRDELEAYEKDGIVTLHTAFSRKEGVPKTYVQHLMAKDAGALISILGRGGHLYVCGDG
SKMAPDVEATLQKAYQSVHETDERQAQEWLLDLQTKGIYAKDVWAGI
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
gtgttagaaagggtgttattcatgaaggaaacaggtccgattccgcagccgaagacattc
ggcccgctcggcaatcttcctttgcttgataaagacaagcctacaatgtcgcttatcaaa
ctggcaaacgagcaggggcctatttttcagctgcatacgccggcgggcgccattatcgtc
gtgtccggccatgaactggtgaaagaggtttgtgatgaagagcggttcgataaaagcatt
gaaggggctttggagaaagtccgggcgttttccggtgacgggctgtttacaagctggacg
catgagcctaactggcgaaaggcgcataatattctgatgccgaccttcagccagcgcgcg
atgaaagattatcattcgatgatgactgatatcgcggtgcagctgattcaaaaatgggct
aggctgaacccggatgaggccgttgatgtgcctgctgatatgacccgcctgacgctcgat
acgatcgggctttgcggctttaactatcggtttaacagctattacagggaaacgcctcat
ccgtttatcaacagcatggtgcgcgcccttgatgaagcgatgcaccaaatgcagcgcctt
gatgttcaggataagcttatgatcaggacgaagcgccaatttcatcatgacattcaggcg
atgttttcgttagtagacagtattattgcagagcgccggtcaggcggccgggatgaaaag
gatctgctggccagaatgctgaatgtggaagacccggaaacgggcgaaaaacttgatgat
gaaaatatccggtttcaaatcatcacgtttttaattgccggccacgaaacgaccagcggc
ctgctttcctttgccatctactttctgctgaaacatccccgtgttttggaaaaagcctat
gaggaagctgatcgggtattgaccgatcccgttccttcatataaacaagtgctggatctt
acttatatccgaatgattttgcaggagtcattgcgtttatggccgaccgcgcctgcgttc
agcctttatgcgaaagaggatacggtgatcggcgggaaatatccgatcacgccgaaagac
agaatttccgtcttaattccccagcttcaccgtgataaagacgcgtggggagacaatgcg
gaggaattttatccggagcggtttgaacatcctgatcaagtgcctcaccatgcgtataag
ccgttcggaaacggtcagagggcgtgtatcggtatgcagttcgccctgcatgaagcaact
cttgttctggggatgattctgcagcattttacctttatcgatcacaccgattatgagctc
gatattaaacagacactaacgatcaagcccggcgactttcatatccgggtgcggccgaga
aacaaagaagccgttgcggctgctctcccggcggctgaaaaagcggcggaagacgtcgaa
aaagaaaaacgggaaacaaaaggcgcatccattatcgggcttgataaccgaccgcttctg
attctgtacggatcagatacgggaaccgcagaaggcgtggcgcgggagcttgccgatact
gccgggatgcacggcgtccggactgaaacggcgcctttaaatgaccggatcggaaaactg
ccgaaagaaggagctctcttgatcattacgtcctcttataacggaaagcctccgagcaac
gcgggacaattcgttcaatggcttgaagaagtcaaacccggggagctggaaggcgtccgg
tatgccgtcttcggctgcggtgatcataactgggcggcgacatatcaggctgtaccgagg
cttattgatgagaagcttgccgaaaaaggggcggaacgcttttcctcccgaggcgagggg
gacgtcagcggcgattttgaaggaaagcttgatgaatggaaaaaaagcatgtggacggac
gccatgaaggcattcggtctcaagctgaatgaaaatgccgaaaaagagcgaagtgcgctg
ggccttcaatttgtcagcgggcttggcgggtctcctttggcacagacgtatgaagcggtt
tacgcatccgttgcggaaaacagggaacttcaggcgccggaaagcggccggagcacaagg
catatcgaaatcactctgccgaaagaggctgcctatcatgaaggggatcatctcggcgtg
ctgccggtaaacagcaaagagcaggtcagccgtgttctccgccggttcaatctgaacggg
aatgatcaagtgctgctgacagccagcggacagagcgcggctcatctcccgctcgatcgg
ccggtcaggctgcatgatcttctgagcagctgtgtcgaattgcaggaagcggcatcaagg
gctcaaatccgggaaatggccgcttatacggtctgcccgccgcacaaacgggaattggaa
gattttcttgaggagggcgtctatcaggagcaaatcttaacatcgcgcgtctcgatgctc
gatctccttgaaaaatatgaagcgtgtgaacttccgtttgagcgatttctggagcttttg
cgcccgttgaagccgcggtattattcgatttcaagttcgccccggaaacatcctgggcag
gcttcaattaccgtcggcgtcgttcgcggccccgcccggagcggtttgggtgagtatcgc
ggagtcgcttcgaattatttagcggaccgcggccctgaggatggtatcgtgatgtttgtc
cgcactccggaaacacgattccggctgccggaagatccggaaaaaccgattattatggtc
ggtcccggcacaggagtcgccccgttccgcggatttctgcaagcccgcgcggcgttaaaa
aaagaaggaaaagagctgggggaggctcatctgtatttcggatgcagaaacgatcatgat
tttatttaccgtgacgagcttgaagcttatgaaaaagacggaatcgtgacgcttcatacg
gctttctcccgcaaagaaggcgtaccgaaaacgtatgtgcagcacttaatggcgaaagac
gccggcgctttaatttccatcctcggccggggagggcacctctacgtatgcggcgacggc
agcaaaatggcgcccgatgtagaggcaacgctgcaaaaagcgtatcagtcggtccacgaa
acagacgaacggcaagcgcaagaatggcttttggacctccagacaaaaggcatttacgca
aaagatgtttgggcggggatttga

DBGET integrated database retrieval system