KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5113: BASU_1764Help
Entry
BASU_1764         CDS       T02796                                 

Gene name
eglS
Definition
endo-1,4-beta-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bamn  Bacillus amyloliquefaciens subsp. plantarum UCMB5113
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BASU_1764 (eglS)
Enzymes [BR:bamn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BASU_1764 (eglS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1866466..1867965)
Genome map
AA seq 499 aa AA seqDB search
MKRAISIFITCLLIAVLTMGGLLPSPASAAETKTPVAKNGQLSIKGTQLVNRDGKAVQLK
GISSHGLQWYGDFVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDI
KPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQSLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLNYLDSKNISWVNWNLSDKQESS
SALKPGASKTGGWPLTDLTASGTFVRENIRGTKDSTKDVPETPAQDNPAQEKGVSVQYKA
GDGRVNSNQIRPQLHIKNNGNATVDLKDVTARYWYNVKNKGQNFDCDYAQMGCGNLTHKF
VTLHKPKQGADTYLELGFKTGTLSPGASTGNIQLRLHNDDWSNYAQSGDYSFFQSNTFKT
TKKITLYHQGKLIWGTEPN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggcaatttctatttttattacgtgtttattgattgcggtattgacaatgggc
ggcttgctgccttcgccggcatcagcagcagagacaaaaacgccagtagccaagaatggt
cagcttagcataaaaggtacacaacttgtaaaccgagacggcaaagcggtacaactgaaa
gggatcagttcacatggattgcaatggtatggcgatttcgtcaataaagacagcttaaaa
tggctgagagacgattggggcataaccgttttccgcgcggcgatgtatacggcagatggc
ggttatattgacaacccgtccgtgaaaaataaagtaaaagaagcggttgaagcggcaaaa
gaacttgggatatatgtcatcattgactggcatattttaaatgacggcaacccaaaccaa
aataaagagaaggcaaaagaatttttcaaggagatgtcaagtctttacggaaacacgcca
aacgtcatttatgaaattgcaaacgaaccaaacggtgacgtgaactggaagcgtgatatt
aaaccgtatgcggaagaagtgatttccgttatccgcaaaaatgatccagacaacatcatc
attgtcggcaccggtacatggagccaagatgtgaatgatgcagccgatgatcagctaaaa
gatgcaaacgtcatgtacgcgcttcatttttatgccggcacacatggccaatctttacgg
gataaagcaaactatgcactcagtaaaggagcgcctattttcgtgacggaatggggaaca
agcgacgcgtctggaaatggcggtgtattccttgaccagtcgcgggaatggctgaattat
ctcgacagtaagaacatcagctgggtgaactggaatctttctgataagcaggaatcatct
tcggctttaaagccgggagcatctaaaacaggcggctggccgcttacagatttaactgct
tcaggaacattcgtaagagaaaacattcgcggcactaaagattcgacgaaggacgtccct
gaaacgccagcacaagataaccccgcacaggaaaaaggcgtttctgtacaatacaaagca
ggggatgggcgtgtgaacagcaatcaaatccgcccgcagcttcacataaaaaataacggc
aatgcgacggttgatttaaaagatgtcactgcccgttactggtataacgtgaaaaacaaa
ggccaaaactttgactgtgactacgcgcagatgggatgcggcaatctgacccacaagttt
gtgacgctgcataaacctaagcaaggtgcagatacctatctggaactggggtttaaaaca
ggaacgctgtcaccgggagcaagcacagggaatattcagcttcgtcttcacaatgatgac
tggagcaattatgcacaaagcggcgattattcctttttccaatcaaatacgtttaaaaca
acgaaaaaaatcacattatatcatcaaggaaaactgatttggggaacagaacccaattag

  All links  
No link information was found.   
DBGET integrated database retrieval system