KEGG   Bacillus velezensis UCMB5113: BASU_1817Help
Entry
BASU_1817         CDS       T02796                                 

Gene name
proJ
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bamn  Bacillus velezensis UCMB5113
Pathway
bamn00330  Arginine and proline metabolism
bamn00332  Carbapenem biosynthesis
bamn01100  Metabolic pathways
bamn01130  Biosynthesis of antibiotics
bamn01230  Biosynthesis of amino acids
Module
bamn_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bamn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BASU_1817 (proJ)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BASU_1817 (proJ)
Enzymes [BR:bamn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BASU_1817 (proJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF2138
Motif
Other DBs
NCBI-ProteinID: CDG26110
Position
complement(1991970..1993088)
Genome map
AA seq 372 aa AA seqDB search
MTSRTKIKRVAVKIGSSSLTSLHGEISRRKLEALVDQIAQLKDSGYEMILVSSGAVAAGY
RKLGFIQKPESLPEKQASASIGQGLLMEAYSKLFLAHGYVASQILITRSDFSDECRYHNV
RNTMNVLLERGIIPIINENDTVTVNRLKFGDNDTLAAKVAGLIDADMLVILSDIDGLYDD
NPRSNPKAKRISHVSDITPEIEASAGDAGSEMGTGGMRSKLDAFKIVMASGIKGFLGQAN
IPDILLQAVDEAAEGTYFEAEGTLPLNHKEQWLAFNSGPEGEIVMEKESSRDVANGNMEL
SPQDIEQIKGRFSSGAVVRLLDQQGEELGLGIVNYSSAQLKTFKETPPKQTDQSVIDPEA
FVCHVELSIPIG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtctcggacgaagatcaaaagagtcgcggtgaaaatcggcagcagctcactgacg
agcctgcacggggaaatcagcagaagaaagctggaagcattggtggatcaaatcgcacag
ctgaaagacagcggctatgaaatgattttagtatcttccggcgcagtggcggcaggttat
cggaagctcggatttattcagaaaccggaaagcctccctgaaaaacaggcttctgcttcc
atcgggcagggattattaatggaggcttattcaaagctgtttttagcgcacggttatgtc
gcatcacaaattttaattacaagaagcgacttttccgatgaatgccgctaccataatgtg
cgcaatacgatgaacgtccttttggaacggggcattattccgattattaatgaaaatgac
acggtcacagtcaaccggctgaaattcggagataacgatacactcgcagcgaaggtggca
ggtttaattgatgccgacatgcttgtgattttatcagacattgacggtttatatgatgat
aatccgcgcagcaacccgaaagcgaaaagaatcagtcatgttagtgacatcactccggaa
atagaagcaagcgcgggagatgccgggagtgaaatgggaaccggcggaatgcgttcgaaa
ctggatgcttttaaaattgtgatggcctccggtattaaaggctttctcgggcaggctaac
attccggacattctgcttcaagcggtagatgaggcggctgaaggaacttattttgaagcg
gaaggaaccctgccgttaaaccacaaagaacaatggcttgcatttaattccggccccgaa
ggcgaaattgtgatggaaaaagaaagcagccgcgatgtcgcgaacggaaatatggagctg
tcaccgcaggacatcgagcagattaagggcagattcagcagcggagcggttgtcaggctg
cttgatcagcagggagaagagctcggactcggcatcgtcaactattcctcagcccagctg
aagacatttaaagaaacgccgcccaaacagaccgatcaatcagtcattgatccggaagcg
tttgtctgccacgttgaactatccattccgatcggctga

DBGET integrated database retrieval system