KEGG   Bacillus velezensis UCMB5113: BASU_1863Help
Entry
BASU_1863         CDS       T02796                                 

Gene name
odhA
Definition
(GenBank) 2-oxoglutarate dehydrogenase (E1 subunit)
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bamn  Bacillus velezensis UCMB5113
Pathway
bamn00020  Citrate cycle (TCA cycle)
bamn00310  Lysine degradation
bamn00380  Tryptophan metabolism
bamn01100  Metabolic pathways
bamn01110  Biosynthesis of secondary metabolites
bamn01120  Microbial metabolism in diverse environments
bamn01130  Biosynthesis of antibiotics
bamn01200  Carbon metabolism
Module
bamn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bamn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BASU_1863 (odhA)
  Amino acid metabolism
   00310 Lysine degradation
    BASU_1863 (odhA)
   00380 Tryptophan metabolism
    BASU_1863 (odhA)
Enzymes [BR:bamn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BASU_1863 (odhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: CDG26155
Position
complement(2032354..2035188)
Genome map
AA seq 944 aa AA seqDB search
MFQNNMKQRMNWEDFYGPNLGYALELYDQYAEDPDSIDPDLKDMFDELGAPPSQIKEASG
TKEQGRVTADLIQKIAAAVKLAEDIRTYGHLNASVNPLRKDPKKSELFPLSEYGLTEEEM
KAIPASVICKDAPANITNGLEAIQHLRNTYKRTISFEFDHVHDFEERAWITKMVESGELF
RKNSPEKLSAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAQSVKAGTT
NVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSTGISYGWTGDVKYHLG
ADRQLQDAETKSARITLANNPSHLEFINPIVEGSTRAAQETRTQKGYPVQDETKSLAILI
HGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIGFTTESDESRSTKYASDLAKGY
EIPIVHVNADDPEACLSAVKFAVEYRKRFNKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHPTVKRIFAEKLVSEGLISEEKAQNIETTVTKRIEDAYKKVPAKKEDAVREIELPE
PVSNGFPDVDTAIDFDVLRKLNGELINWPESFNVFGKLKRILERRAKAFDDDRKVEWSLA
ESLAFASILKDGTPIRLTGQDSERGTFAQRNLVLHDSETGEEFVALHHLDDCAASFTVHN
SPLSEGSVLGFEYGYNVYSPETLVMWEAQYGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRVERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNTVSEVQELSESRFKPVYEQSGLSHACEKVTRVVLSSGKVSIDISDHF
NKMEGDKDWLHIARIEQLYPFPAKDTKELFAKLPNLQEIVWVQEEPQNMGAWSYISPYLT
EIAPKGVNVQYIGRRRRSSPAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaataatatgaaacaaagaatgaattgggaagatttttacggaccgaacctc
ggctacgcactggagctgtacgaccaatatgctgaagatccagacagcattgatccggat
ctgaaagacatgtttgacgaactaggcgctccgccaagccaaataaaagaggcatcggga
acaaaggaacagggacgcgtcaccgcagatctgattcaaaagatcgcagcagcagttaaa
cttgcagaagatattcgaacctatggccatctgaacgcttccgtcaatccgctcagaaag
gatccgaaaaagagcgagctctttccgttatccgagtacgggcttacagaagaagaaatg
aaagcaatacccgcgtctgtcatctgtaaagacgcacctgccaatataacaaacggctta
gaagccatccagcatttacgcaatacctataaaagaaccatctccttcgagtttgaccat
gtgcatgatttcgaagagcgcgcatggattacaaaaatggtcgaatccggagaactgttc
cggaaaaattcaccggaaaaactgtcagccgttttagaaagactgacggaagtagaagga
tttgaacaatttttacaccggacattcgtcggtcagaagcgtttctcaattgaggggtta
gacgcgcttgtgccggttcttgacgacattatcgcccagtctgtgaaagcgggcacaacc
aatgtcaatatcgggatggcgcacagaggccgtttaaatgtgcttgcgcatgtgctcggc
aaaccgtatgagattattttctcagaattccagcacgcgccgaataaagaccttgtgccg
tctgaaggatcgaccggcatcagctacggctggacgggcgatgtaaaataccacctcggt
gcagacagacagcttcaggatgctgaaaccaaaagcgcgcggattacgcttgcaaataac
ccgagccatttggaattcatcaatccgattgttgaaggaagcacgcgggcggcacaggaa
acaagaacgcaaaaggggtacccggttcaagacgaaacaaaatcgctcgccattttaatt
cacggtgacgcagcgtttccgggagaaggcattgtcgccgagacgctgaacttaagctct
ctgaaaggctatcaggtcggcggggccattcatatcatcgccaataatatgatcggcttt
acaactgaaagcgatgaatcacgatccacgaaatatgccagtgatttggcgaagggctat
gaaattccgatcgttcacgtcaacgcggatgatccggaagcatgcctgtcagccgttaaa
tttgcggttgaataccggaagcggttcaataaagatttcttaatcgatttaatcgggtac
agacggtacggccacaatgaaatggatgagccgtcaacgacacagccgatgctgtatgac
gccgtcagaaaacacccgactgtcaagcggatctttgcggaaaaactcgtaagtgaagga
ctgatcagcgaggaaaaagcgcaaaacatcgaaacgacagtgacaaaacgaattgaagac
gcctataaaaaggtgcccgccaaaaaagaagacgccgtacgggaaattgaattgccggaa
ccggtgtccaacggttttccagacgttgacacagccattgattttgatgttctccgcaag
ctgaacggcgaacttatcaactggccggaatcttttaacgtgttcggcaagctgaaaaga
atcctggaaagacgtgcaaaagcgtttgatgatgaccgtaaagttgaatggtcattggct
gaatcgcttgcgtttgcttccattttgaaagacggcacgccgatccggctgaccggacag
gattcagagcgcggaacgttcgctcaaagaaaccttgtgctgcatgacagcgaaacagga
gaagaatttgttgccctccatcacttagacgactgcgctgcttcatttacggtgcataac
agcccgctctctgaaggatcggttctcggctttgaatatggatacaacgtgtattcgcct
gaaacgcttgtgatgtgggaggcgcagtacggggactttgccaatgcggctcaagtctat
tttgatcaattcatatctgcaggacgggcaaaatggggacaaaaatcaggactggtcatg
ctgctgcctcacggttacgaagggcagggccctgaacactccagcggccgcgtcgagcgg
ttcctgcagctggcggcggaaaacaactggacggtggccaacctgacaagtgcggctcag
tatttccatattttaagaagacaagcgaaaatgctgcttcgtgaggaaatccgcccgctt
gtgatcatgacgccgaagagcctgctgcgcaacccgaatacggtatctgaagtgcaggaa
ctgagcgaaagccgattcaagcctgtctatgagcagtccggtctttcccatgcttgcgaa
aaagtgactcgcgtcgtattatcaagcggaaaagtgtcaattgatatcagcgatcacttc
aacaaaatggaaggcgataaggattggcttcatattgccagaatcgaacagctgtatccg
ttcccggcaaaagatacgaaggagcttttcgccaaactgccgaacctgcaagagatcgtt
tgggttcaggaagagccgcagaacatgggggcatggagttatatcagcccgtatctgacg
gaaatcgcgccaaaaggagtaaatgtccaatacatcggccgaagaagacgatccagtccc
gcagaaggagatccgacagtccacaaaaaagaacaggaacgcattgtatctgatagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system