KEGG   Bacillus velezensis UCMB5113: BASU_2170Help
Entry
BASU_2170         CDS       T02796                                 

Gene name
mmgA
Definition
(GenBank) degradative acetoacetyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bamn  Bacillus velezensis UCMB5113
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bamn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BASU_2170 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BASU_2170 (mmgA)
   00640 Propanoate metabolism
    BASU_2170 (mmgA)
   00650 Butanoate metabolism
    BASU_2170 (mmgA)
  Lipid metabolism
   00071 Fatty acid degradation
    BASU_2170 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BASU_2170 (mmgA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BASU_2170 (mmgA)
   00310 Lysine degradation
    BASU_2170 (mmgA)
   00380 Tryptophan metabolism
    BASU_2170 (mmgA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BASU_2170 (mmgA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BASU_2170 (mmgA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BASU_2170 (mmgA)
Enzymes [BR:bamn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BASU_2170 (mmgA)
Exosome [BR:bamn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BASU_2170 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2367279..2368460)
Genome map
AA seq 393 aa AA seqDB search
MGKTVIVSAARTPFGKFGGALKEVKAAELGGIAIKEAIKRAAISESEAEGTVMGMVVQAG
AGQIPARQAARYAGLPWSVPAETINKVCASGLRAVTICDQMIRAKDADVLIAGGMESMSN
IPYAIPAGRWGVRMGDGVFQDLMVHDGLTCAFDQVHMAVHGSTAAKKYGISRDEQDHYAL
LSQKRAAEAAEAGKLREEIVPVTWTGKKGKQHTVEADEGLRPDTSLEQLAALKPIFTADG
TVTAGNAPGVNDGAGAFVLMSEEKAAKQHVRPLAAILGFASVGLEASELASAPGEAISRL
LTKTGLSVEDIDLFEVNEAFASVVLVSEKIAGFSREKVNVNGGAIAFGHPIGASGARIIM
SLIYELKRRGGGLGIAAICSGAAQGDAVLLEVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacggttatcgtcagtgcggcaagaacgccgttcggaaaatttggcggcgca
ttaaaagaggtaaaggcggccgagcttggcggcatcgccataaaagaagcaatcaagcgc
gccgctatcagtgaaagcgaagcggaaggaacggtgatgggaatggtcgtccaggcgggt
gccgggcagattccggcacggcaggctgcaagatatgccgggcttccgtggtccgttccg
gctgaaaccattaataaggtctgtgcatcagggctcagggccgttaccatctgtgatcaa
atgatccgggcgaaagatgcggacgtgctgattgcaggcggaatggaaagcatgagcaac
attccgtacgccattccggccggccgctggggtgtgaggatgggggacggggtgtttcag
gatttaatggttcatgacgggctgacctgtgcgttcgaccaggtgcatatggctgtccac
ggaagcactgcggccaaaaagtacggcatttcccgggatgaacaggatcattacgctctt
ttgagccagaaacgcgcggctgaggcggccgaggcgggcaaattgcgtgaagaaattgtc
cccgtcacctggaccggcaaaaagggcaaacagcataccgttgaagcggatgaggggctg
cgccctgatacgagccttgagcagcttgcagcgctcaagccaatttttacagccgacgga
acggttacagccggaaacgctcccggtgtaaatgacggggccggagcatttgtgctgatg
tcagaggaaaaagccgcgaagcagcatgtcaggccgctcgcagcgatacttggctttgcg
tcagtcggactggaagcgtccgagctggcaagcgcgccgggagaggccatcagccggctc
ttgacaaaaaccggactgtccgttgaagatattgatttgtttgaagtaaatgaagcattt
gcgtccgtcgtgctcgtgagtgaaaaaatagccgggttcagccgggaaaaagtgaatgta
aacggaggggcaatcgcgttcggccacccgatcggcgcaagcggagcgagaatcatcatg
agtttaatatacgaattaaagcgtcgcggaggaggtttaggcatagcggctatatgcagc
ggagcggctcaaggagatgccgtcctgcttgaggtgtactga

DBGET integrated database retrieval system