KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5113: BASU_3228Help
Entry
BASU_3228         CDS       T02796                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bamn  Bacillus amyloliquefaciens subsp. plantarum UCMB5113
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bamn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BASU_3228 (rbsK)
Enzymes [BR:bamn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BASU_3228 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3423167..3424048
Genome map
AA seq 293 aa AA seqDB search
MSEICVIGSCSMDLVVTSERRPKAGETVLGTDFQTVPGGKGANQAVAASRLGANVYMVGK
AGNDSYGKAIIENLKANGVNTDYMETVTHKKSGTAHIVLAEGDNSIVVVKGANDDISPDY
AKSALAKLPGIDIVLIQQEIPEETVEEVCSYCRAQQIPVILNPAPARPLKQSTIEDAAYL
TPNEHEASILFPDRTKEEALAGYPGKLFITEGKQGVRYSDGTAERLVPAFPAEAVDTTGA
GDTFNAALAVALAEGRDIEQALLFANRAASLSVQHFGAQGGMPARKEVEELLS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatttgtgttatcggaagctgttctatggatctggtcgtcacatccgaacgg
cgtccgaaagccggagaaaccgtactgggcacagactttcaaaccgtgcccggaggaaaa
ggcgcaaatcaggccgtagccgcttcccgcctgggcgcaaacgtatatatggtaggaaaa
gcaggcaatgacagctacggaaaagcgattattgaaaacctgaaggcaaacggtgtcaat
acggactatatggaaacggttacacataaaaaaagcggaacggctcatattgtgctcgca
gaaggagacaacagcatcgtcgtcgtaaaaggcgcaaacgatgacatctcccccgattat
gccaaaagtgcgctggcaaaacttcccggcattgatatcgtgctgatccagcaggagatt
cctgaagaaaccgttgaagaagtgtgcagctactgccgcgcgcagcaaattccggttatc
ctgaatcccgcgccggcccggccgctgaaacaatcgacgattgaggatgccgcatatctt
acgccgaacgaacatgaagcgtccattttatttcctgaccggacgaaagaagaagcgctc
gccggctatcccggcaaactgttcattaccgaaggaaaacaaggcgtgcgctactcagac
ggcaccgcggaacggcttgttcccgccttccctgcagaagcggtcgacacgacgggagcc
ggcgatacctttaatgcggcacttgccgtcgcactcgcggaaggacgggacattgagcaa
gcgctcctgtttgccaaccgcgccgcctccctgtccgtgcagcacttcggcgcccaaggc
gggatgccggccagaaaagaagttgaggagctgctgtcatga

DBGET integrated database retrieval system