KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5113: BASU_3290Help
Entry
BASU_3290         CDS       T02796                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase A (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bamn  Bacillus amyloliquefaciens subsp. plantarum UCMB5113
Brite
Enzymes [BR:bamn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     BASU_3290 (xynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3480077..3480718
Genome map
AA seq 213 aa AA seqDB search
MFKFKKKFLVGLTAAFMSISMFSATASAAGTDYWQNWTDGGGTVNAVNGSGGNYSVNWSN
TGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRAPLIEYYVVDSWGTYRPTG
TYKGTVNSDGGTYDIYTTTRYNAPSIDGDNTTFTQYWSVRQSKRPTGSNAAITFSNHVNA
WKSHGMNLGSNWAYQVLATEGYKSSGSSNVTVW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtttaaaaagaaattcttagttggattaacggctgctttcatgagtatcagc
atgttttcggcaaccgcctctgcagctggcacagattactggcaaaattggactgatggg
ggcggaacagtcaacgctgtcaatggatctggcgggaattacagtgttaattggtctaat
accggaaatttcgttgttggtaaaggctggactacaggctcgccatttagaacaataaac
tataatgccggagtctgggcgccgaatggcaatggatatttgactttatatggctggacg
agagcacctctcatcgaatattatgtagtggattcatggggtacttacagacctaccgga
acgtataaaggtactgtaaacagtgatggaggtacatatgacatatatacaacgacacgt
tataacgcaccttccattgatggcgataacactacttttacgcagtactggagtgttcgc
cagtcgaagagaccgaccggaagcaacgctgcaatcactttcagtaatcatgttaacgca
tggaagagccatggaatgaatctgggcagtaattgggcttatcaagtcttagcgacagaa
ggatataaaagcagcggaagttctaatgtaacagtgtggtaa

DBGET integrated database retrieval system