KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5113: BASU_3334Help
Entry
BASU_3334         CDS       T02796                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bamn  Bacillus amyloliquefaciens subsp. plantarum UCMB5113
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bamn00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3516236..3516820)
Genome map
AA seq 194 aa AA seqDB search
MYIMKQSGWLELICGSMFSGKSEELIRRVKRATYAKQEVKVFKPAIDNRYSEEAVVSHNG
TSMTSHVISSSAEIWDHISESTDVIAVDEVQFFGESIIGDLSSLADKGYRVIAAGLDMDF
RGEPFGVVPNLMAVAESVTKLQAVCSVCGSPASRTQRLIDGKPASYDDPVILVGASESYE
ARCRHHHEVPKKTD
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtacataatgaagcaaagcggatggcttgagctgatatgcggcagcatgttctctggg
aaatcagaagagctgatccgcagagtgaaaagagcgacatatgcaaagcaggaggtcaag
gtattcaaacctgccattgataatcgctacagtgaggaggccgtcgtttctcacaacggc
acatccatgacaagccacgtcatctcgtcttcggctgaaatatgggatcatatcagtgaa
agcacggacgtcatcgcggtagatgaggtgcagtttttcggcgaatcgatcatcggcgac
ttatcctcgcttgcggataaaggctatcgtgtcatcgcggccggacttgatatggatttc
cggggagagcctttcggcgtggtgccgaatctgatggcggttgccgaatcggtgacgaag
ctgcaggcggtctgctccgtttgcgggtcgccggcaagccgtacgcagcgtttgattgac
gggaagcccgcttcctatgatgatccggtcattttagtcggcgcatcggagtcatacgaa
gcgagatgcagacatcatcacgaagtgccgaaaaaaacagactga

DBGET integrated database retrieval system