KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5113: BASU_3334Help
Entry
BASU_3334         CDS       T02796                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bamn  Bacillus amyloliquefaciens subsp. plantarum UCMB5113
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BASU_3334 (tdk)
Enzymes [BR:bamn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BASU_3334 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3516236..3516820)
Genome map
AA seq 194 aa AA seqDB search
MYIMKQSGWLELICGSMFSGKSEELIRRVKRATYAKQEVKVFKPAIDNRYSEEAVVSHNG
TSMTSHVISSSAEIWDHISESTDVIAVDEVQFFGESIIGDLSSLADKGYRVIAAGLDMDF
RGEPFGVVPNLMAVAESVTKLQAVCSVCGSPASRTQRLIDGKPASYDDPVILVGASESYE
ARCRHHHEVPKKTD
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtacataatgaagcaaagcggatggcttgagctgatatgcggcagcatgttctctggg
aaatcagaagagctgatccgcagagtgaaaagagcgacatatgcaaagcaggaggtcaag
gtattcaaacctgccattgataatcgctacagtgaggaggccgtcgtttctcacaacggc
acatccatgacaagccacgtcatctcgtcttcggctgaaatatgggatcatatcagtgaa
agcacggacgtcatcgcggtagatgaggtgcagtttttcggcgaatcgatcatcggcgac
ttatcctcgcttgcggataaaggctatcgtgtcatcgcggccggacttgatatggatttc
cggggagagcctttcggcgtggtgccgaatctgatggcggttgccgaatcggtgacgaag
ctgcaggcggtctgctccgtttgcgggtcgccggcaagccgtacgcagcgtttgattgac
gggaagcccgcttcctatgatgatccggtcattttagtcggcgcatcggagtcatacgaa
gcgagatgcagacatcatcacgaagtgccgaaaaaaacagactga

DBGET integrated database retrieval system