KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5113: BASU_3413Help
Entry
BASU_3413         CDS       T02796                                 

Gene name
rocG
Definition
glutamate dehydrogenase (EC:1.4.1.2)
Orthology
K00260  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
bamn  Bacillus amyloliquefaciens subsp. plantarum UCMB5113
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:bamn00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bamn00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bamn00330]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:bamn00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3593103..3594389)
Genome map
AA seq 428 aa AA seqDB search
MSANPISKSNQKDEEKEVLNLFLSTQSIIKEALRKLGYPDNMYELMKEPMRLLTVRIPVK
MDNGSVQVFTGYRSQHNDAVGPTKGGVRFHPEVSEEEVKALSIWMTLKCGITNLPYGGGK
GGIICDPRTMSFGELERLSRGYVRAISQIVGPTKDIPAPDVYTNSQIMAWMMDEYSRLRE
FDSPGFITGKPIVLGGSQGRETATAQGVTICIEEAVKKKGIPLENARIIIQGFGNAGSFL
AKFMHDAGAKVIGISDAHGALYDPDGLDIDYLLDKRDSFGTVTNLFSDVITNRELLEKDC
DILVPAAISNQITAENAHHIKASIIVEAANGPTTIDATKILNERGVLLVPDILASAGGVT
VSYFEWVQNNQGFYWSEEEVAGKLRSVMVNSFESIYQTAHTHKVDMRLAAYMTGIRKSAE
AARFRGWV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccaacccgatttctaaaagcaatcagaaagatgaagaaaaagaagttcttaat
ttgttcttgtcaacacaatcgatcataaaagaggccctgcgaaaactggggtaccctgac
aatatgtatgaactgatgaaagagccgatgcggcttttaaccgtccgcatccctgtcaaa
atggacaatggctcagtacaggttttcacgggctaccgctcacagcataatgacgcagtc
ggcccgacaaaagggggcgtgcggtttcatccggaagtcagtgaagaagaggttaaggcg
ctttccatctggatgactttaaaatgcggcatcacaaatcttccttacgggggcggaaaa
ggcggcatcatctgtgatcctcggacgatgtcattcggagagctggaacggctgagccgc
ggatatgtgcgtgcgatcagccagatcgtcggtccgacaaaggatattccggctcccgac
gtatataccaactcgcagattatggcatggatgatggacgaatacagccgcctgagagaa
tttgattcaccgggattcattacgggcaaaccgattgttctcggcggttcacaggggcgg
gagacggcgaccgcgcaaggcgtcacgatttgtattgaggaagccgttaagaaaaaaggg
attccattggaaaatgcgcggatcatcattcaggggttcggaaatgcggggagctttctc
gctaaatttatgcatgacgccggcgccaaggtgatcggcatctcagacgcccacggcgct
ttgtatgaccctgacggccttgacattgattacctgctggataagcgggacagcttcggc
acggtgacgaatctcttctcggatgtcataacgaacagggagctgctggaaaaggactgt
gatattctcgtgcccgccgcaatctccaatcagattacggctgaaaacgcccatcacatt
aaagcttcaatcattgtggaggcggcaaacggcccgacaacgatagatgccacgaaaatt
ctgaatgaaagaggcgtgcttctcgtgccggatattttggcaagcgccggcggcgtgacg
gtgtcttattttgaatgggtgcaaaataatcaaggcttttactggtctgaggaggaagtc
gccggaaaactgcgcagcgtcatggtgaattcgtttgaatccatttatcagacagcgcat
acccacaaagtcgatatgcgtttggccgcctatatgacgggcatcagaaagtcggctgaa
gcggcccgtttccgcggctgggtataa

DBGET integrated database retrieval system