KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_00115Help
Entry
B938_00115        CDS       T02382                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B938_00115 (recR)
DNA repair and recombination proteins [BR:bamp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      B938_00115 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
30064..30660
Genome map
AA seq 198 aa AA seqDB search
MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDTVLDFAKALVNAKRNLTYCSIC
GHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPE
DIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatcctgaaccaatatcaaagctgattgacagctttatgaaattgccagggatc
ggaccgaaaacagcggttcgtctggctttttttgttctaggtatgaaagaagacacagta
ttggattttgctaaggcgcttgtcaatgcgaagcggaatctgacatattgctcgatttgc
ggacatataacagatcaggacccttgttatatatgtgaggacacaagaagggataagtct
gttatttgtgtcgtgcaggaccctaaggatgtgatcgcaatggagaaaatgaaggaatat
aacggccagtatcatgttcttcacggcgcgatttcaccaatggacggcatcggcccggag
gatattaagattccggagctgctgaaacgtcttcaggatgatcaagtgacagaagttatt
ctcgcaaccaaccctaatattgaaggggaagcaacagcgatgtatatatcaaggctgtta
aagccctcaggcatcaagctctcccgtattgcccacggtctgcccgtcggcggtgatttg
gaatatgctgatgaggtcactctttcaaaagctcttgaaggaagacgtgaattgtaa

DBGET integrated database retrieval system