KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_00410Help
Entry
B938_00410        CDS       T02382                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bamp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87592..88095
Genome map
AA seq 167 aa AA seqDB search
MNNTAYIGLGSNMGDREHYLRQAVAMLSRHHGVTVSKVSSIYETDPVGYEDQDQFLNMAV
EVKTSLSPFELLDVTQSIEAELGRTREIRWGPRTADLDILLYNRENIETERLIVPHPRMY
ERLFVLAPLKEICPQADHITISAETNQEGVRVWKQKSGVGEFVHSES
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatacggcatatatcggcctcggctccaatatgggcgaccgtgaacattatttg
cgtcaggcagtggccatgctcagccggcatcatggcgtgacggtgtcaaaggtgtcctcc
atatatgaaacagatcccgtcggctatgaggatcaagatcagtttctcaatatggcggtt
gaagtgaaaacgtcgttatctccttttgaacttcttgatgtaacgcagagcattgaagct
gaattaggcagaacgagagagattcgctggggaccgcggacggcagaccttgacattttg
ctgtataatcgtgaaaatattgaaacagagcggctgattgttccgcatccgagaatgtat
gagcgcttatttgtccttgcgccgttaaaagaaatatgtccgcaggcggatcatatcacg
ataagcgctgaaacaaaccaagaaggtgtaagagtatggaagcagaaatctggggtaggc
gaattcgtgcattcagaaagctga

DBGET integrated database retrieval system