KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_01215Help
Entry
B938_01215        CDS       T02382                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B938_01215
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    B938_01215
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B938_01215
Enzymes [BR:bamp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     B938_01215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
256258..258009
Genome map
AA seq 583 aa AA seqDB search
MTHDGRLDEWIKELENKSFQNNTFDRRAFIQGAGKIAGLSLGLAIAQSIGAFEVNAAPKF
SNYPFTLGVASGDPLSDSVILWTRLAPDPLNGGGMPKQAVPVKWEIAADEHFRHIVKRGT
EMAKPNLGHSVHVEADGLKPNKVYYYRFKSGHELSPVGRTKTLPAPGADVSAMTFAFASC
QQYEHGYYTAYKHMAKEKLDLVFHLGDYIYEYGPNEYVSKTGNVRTHSSAEVYTLSDYRN
RHAQYRSDANLKAAHAAFPWVVTWDDHEVENNYANIIPEKGQSVEAFVLRRAAAYQAYYE
HMPLRRMSLPNGPDMRLYRQFSYGNLASFNVLDTRQYRDDQANGDGNKPPSDEWRDPKRT
LMGTEQEQWLFGNLAASKAKWNVLAQQIFFAQWNFGTTANPIYSMDSWDGYPAQRERVIN
FIKSKNLNNVIVLTGDVHASWASNLHTDFNQTNSKIFGAEFVGTSITSGGNGADKRADTD
QILKQNPHIKFFNDYRGYVRCTVTPAQWRADYRVVPYVTEPGAEVSTRASFIYQKDQTGI
RKVSQAAVAGGLKQSNEVEEDRFFAHNNAHEKQMRKKQPKISQ
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgacacatgacggccgtttagatgaatggatcaaggaattggagaacaaaagctttcag
aacaatacgtttgaccgccgcgcatttatacagggcgccgggaaaatcgccggtctttcc
ctcgggttagcgatcgcgcaatccatcggcgcgtttgaagtgaatgccgctccgaaattt
tcaaactatccgttcaccctcggcgtagcttccggcgacccgctgtctgacagcgtcatt
ctctggacgcgtcttgcccctgacccgctgaatgggggcggcatgccgaagcaggccgtg
ccggtaaaatgggaaatcgccgctgatgaacattttcgtcacatcgtcaaacgcggaacg
gaaatggccaagccgaatctcggacactccgtccatgtcgaggcggacgggctcaagccc
aataaagtgtactattaccggtttaaaagcgggcatgagctcagtcccgtcggccggacg
aaaacgctgcccgctcccggcgctgacgtatccgccatgacgtttgcatttgcctcatgc
cagcagtatgaacacggctattatacggcgtataaacatatggcgaaggaaaagcttgat
ctcgtgttccatctcggagattacatttatgaatacggaccgaacgaatatgtgtcaaaa
acgggaaatgtcaggacgcacagcagcgctgaagtgtatacactgtcagattaccgcaac
cgtcatgcccaataccgctctgatgccaatctgaaagccgcccacgccgcatttccgtgg
gtcgtgacgtgggacgatcatgaggtggaaaacaattatgccaatattatccctgaaaaa
ggccaatccgttgaagcgtttgtgctcaggagggccgcagcttatcaggcttattatgaa
cacatgccgctcaggcgcatgtcattgccgaacggtcctgatatgcggctgtacaggcaa
ttttcttatggcaatttagcatcgttcaatgtgcttgatacaagacagtacagagatgat
caggccaacggcgatgggaataagccgccttctgatgagtggagagacccgaagcgtaca
ttgatggggacagaacaggagcaatggctgttcggaaatttagctgcctcaaaagcgaag
tggaatgtgctggcgcagcaaatctttttcgcgcaatggaatttcggaacaaccgccaat
ccgatatacagcatggattcatgggacggctacccggctcagcgggagcgggtcatcaat
tttataaaaagcaaaaacctgaacaatgtcatcgtgctgacgggtgatgttcacgcaagc
tgggcgtcaaacctgcataccgattttaatcaaacgaattcaaagattttcggagccgaa
ttcgtcgggacctccattacatctggaggaaacggggcggataaacgggccgatacggat
cagatcttaaaacaaaacccgcatattaagtttttcaacgattaccgcggctatgtccgc
tgtacggtgacccctgcccaatggagagcggattacagagtggtgccgtacgtgacggag
ccgggggctgaggtatccacgcgggcttcattcatttatcagaaagaccagacggggatt
cggaaggtctctcaagctgcggttgcaggcggtttaaagcagtcaaacgaggtggaagag
gatcgtttcttcgcccataacaatgcgcatgaaaagcaaatgagaaagaaacagcccaaa
atctcacaataa

DBGET integrated database retrieval system