KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_01555Help
Entry
B938_01555        CDS       T02382                                 

Definition
hypothetical protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bamp00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
329397..330833
Genome map
AA seq 478 aa AA seqDB search
MIHKKQGLFPDTFLWGSASAAYQVEGAWNKDGKGPSVWDLFTKIPGKTFKGSNGDTAVGH
YERYKEDIALMAEMGLKAYRFSVSWPRIFPNGRGEINESGIAFYEDLIDELISNDIEPVL
TLYHWDLPQALMDEYGGFESRKIIDDFNNYCIALYKRFAGKVKYWVTLNEQNYNFHNGFI
TAAHPPGVKDRKRFYEANHIAFLANAKAIESFRQYVPGGMIGPSFAYSPAYPLTSHPEDI
TAFENAEEFMNHWWLDMYCRGTYPQIPFNYLKEKGWAPAIEAGDMELLAKGKPDFIGVNY
YQTITYERNPLDGVSEGKMNTTGQKGTNQDTGIPGLFKTKKNPNLVTSNWDWTIDPIGLR
IGLRRITSRYELPVFITENGLGEFDKIEEYGSIQDDYRIDYLRSHLEQCREAISDGVHLI
GYCSWSFTDLLSWLNGYQKRYGFVYINRDEEDEKDLKRIRKKSFYWYQNVIETNGKSL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgatacataaaaaacagggcctgttccctgatacatttctatgggggtcagcctcggct
gcctatcaggttgaaggagcctggaataaagacggtaaaggaccttcagtatgggactta
ttcacgaaaataccgggtaaaacgtttaaaggctcaaatggcgatacagcagtcggccat
tatgagcgttataaagaagatatcgccttgatggcagaaatgggtttgaaagcttaccgc
ttttctgtcagctggccgagaatttttccgaatggcagaggggaaatcaacgaatcaggg
atcgcattttacgaagacctgatcgatgaattgatttctaacgatattgagccggtgctg
actctttatcactgggacttgcctcaggcgctgatggatgaatacggcggctttgaatca
agaaaaattattgatgattttaataattactgtattgcgttatacaaaagattcgccggc
aaggtgaaatactgggtcacgttaaatgagcagaattataattttcataacgggtttatt
acagctgcacatccgcccggcgtaaaggacagaaaacgattttatgaagccaatcatatc
gcatttttagctaatgccaaagcgattgaatccttcagacaatatgttcctggcggcatg
atcggcccgagcttcgcttattcaccggcttatccgcttacaagtcatcctgaagacata
actgcatttgaaaacgcagaggaatttatgaatcattggtggcttgatatgtattgccgg
gggacttatccgcaaattcctttcaattatttaaaggaaaagggctgggcgcccgccatt
gaagccggggatatggaattgcttgcaaaaggcaagccggattttatcggtgttaattat
tatcagacgattacgtacgaaagaaatcctcttgacggtgtatcggaggggaaaatgaac
acgactggtcagaaagggacaaaccaggatactggtataccggggctgtttaaaacgaaa
aagaatcctaacctcgtgacgagtaattgggattggacgattgacccgataggtctgcgc
atcggcctccggcgtataacgagccgctatgagctgccggtttttataacagaaaacggg
ctgggggaattcgataaaatagaagaatacggctcaattcaggatgattacagaattgac
tatttacgctcccatcttgaacagtgcagagaggccattagtgacggagttcatctcatc
ggctactgcagctggtcattcacggatctgttaagctggctgaacggctatcaaaaacgc
tacggttttgtctatatcaatcgagatgaagaagatgaaaaggatttgaaacggatcagg
aaaaaaagtttttattggtaccagaatgtaattgaaacaaacggtaaaagtttataa

DBGET integrated database retrieval system