KEGG   Bacillus velezensis AS43.3: B938_03995Help
Entry
B938_03995        CDS       T02382                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bamp  Bacillus velezensis AS43.3
Pathway
bamp00010  Glycolysis / Gluconeogenesis
bamp00020  Citrate cycle (TCA cycle)
bamp00620  Pyruvate metabolism
bamp01100  Metabolic pathways
bamp01110  Biosynthesis of secondary metabolites
bamp01120  Microbial metabolism in diverse environments
bamp01130  Biosynthesis of antibiotics
bamp01200  Carbon metabolism
Module
bamp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B938_03995
   00020 Citrate cycle (TCA cycle)
    B938_03995
   00620 Pyruvate metabolism
    B938_03995
Enzymes [BR:bamp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B938_03995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N PYNP_C HlyD_D23 GCV_H EF_TS
Motif
Other DBs
NCBI-ProteinID: AFZ89827
Position
825257..826450
Genome map
AA seq 397 aa AA seqDB search
MAVKVVMPKLGMAMKKGEVSVWNKKVGDPVEKGESIASINSEKIEMEIEAPESGTLLHIK
VKEGEGVPPGTPICYIGENGEEVREKEAPAPENAGKPQSEPEHIPAPKAVQKRKHRVKIS
PVARKMAEKAGLKVETLNGTGPGGRIVKADVIKAMKTEAEPQSSVQTAQPEGKPASAMRK
VIADRMHKSLQNSAQLTLTMKADITELVKWQQQLADSAKKRSGVKLTVTHFVSRAAVLAL
KQHPELNSSYQEERIITYPYVHLGMAVSLENGLVVPVIRDAEKLSFLELADHISTSARRA
REGNASGDDLHGSTFSITNLGGYGIEHFTPILNPPEAGILGVGASYETPAFKGDELVKST
MLPLSLTFDHRVCDGAPAADFLKTVKALLEEPAGLIL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaaagtagtaatgccgaagctgggaatggcgatgaagaaaggtgaagtatcc
gtctggaataaaaaagtcggcgacccggttgaaaagggagaaagcatcgccagcatcaac
tcggaaaaaatagaaatggaaatagaagcgcctgaaagcggcacgcttctccatattaaa
gtcaaagagggagaaggagtcccgccgggaacgcccatctgttatatcggggaaaacggc
gaagaagtgcgggagaaggaggcgccggctcctgaaaatgcagggaaaccgcaatctgaa
cctgaacatattcccgctcccaaagccgtgcaaaagcgtaaacaccgcgtgaaaatatct
cccgttgcccgaaaaatggcggagaaagccgggttgaaagttgaaacgctgaacgggacg
gggcctggaggcagaatcgtaaaagctgacgtcatcaaggccatgaagacggaagctgaa
ccgcagtcctcggttcagacggcacagccggagggaaaaccggcttcagcgatgagaaaa
gtgattgcagaccgaatgcacaaaagcctgcaaaacagcgcccagctgacgctgacgatg
aaagcggacattacggagcttgtaaaatggcagcagcagctcgccgacagcgcgaaaaag
cggagcggtgttaaactgacggtcacacatttcgtatcccgggccgcggtgcttgcgctg
aaacagcatcctgagctgaacagctcttatcaagaggagcggatcatcacctatccatat
gtccacctcgggatggcggtttctcttgaaaacggtctcgtcgtgccggtgattcgggat
gcggaaaagctttcattccttgagcttgcggatcacatcagcacatcggcacgccgggcg
cgggaaggcaatgcttccggagatgatctgcacggatcgacattttctattacaaatctc
gggggttacggaattgagcatttcaccccgattcttaatccgcctgaagccggtattctc
ggagtgggcgcaagctatgaaacgcctgcgtttaaaggagatgaacttgtcaaaagcacc
atgctgccgctgagccttacctttgatcacagagtatgtgacggcgcaccggctgcggac
ttcctgaaaacggtcaaagcgctgcttgaagagccggccggattgattttatag

DBGET integrated database retrieval system