KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_04560Help
Entry
B938_04560        CDS       T02382                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bamp00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
940594..942084
Genome map
AA seq 496 aa AA seqDB search
METYILSIDQGTTSSRAILFNKEGKIVHSAQKEFTQHFPQPGWVEHNANEIWGSVLAVIA
TVISESGISADQIAGIGITNQRETTVVWDKDTGKPVYNAIVWQSRQTSGICEELREKGYN
DTFREKTGLLIDPYFSGTKVKWILDNVEGAREKSENGSLLFGTIDSWLIWKMSGGAAHVT
DYSNASRTLMFNIHELKWDDELLDILGVPKSMLPEVKPSSHVYAKTVDYHFFGKNIPIAG
AAGDQQSALFGQACFEEGMGKNTYGTGCFMLMNTGEKAITSDHGLLTTIAWGLDGKVEYA
LEGSIFVAGSAIQWLRDGMRMFQDSKESETYAERVDSADGVYVVPAFVGLGTPYWDSDVR
GSVFGLTRGTTKEHFIRATLESLAYQAKDVLDAMEADSGISLKTLRVDGGAVKNNFLMQF
QSDLLDVPVERPEINETTALGAAYLAGIAVGYWKDSTEIADQWNLDKQFKPEMEDEKRDE
LYGGWKKAVNAAMAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggagacctatattttatcaattgaccaaggcacaacaagttcaagagcgattcttttt
aataaagaaggaaaaatcgtgcattccgctcaaaaggaattcacacagcatttccctcag
ccgggctgggtggagcacaatgcgaacgaaatttggggatcggtgctcgccgttatcgcg
actgtgatctccgagtccggaatcagcgctgatcaaattgccggcatcggcatcacgaac
caaagggaaacgacggtcgtatgggataaagataccggaaagccggtatacaatgcgatt
gtatggcaatcgagacaaacatccggcatttgcgaagagcttcgtgaaaaaggatataat
gatacattcagagaaaaaacgggacttttgatcgacccttatttctcaggaacgaaagtc
aaatggattcttgacaatgtagaaggcgcgcgggaaaaatcggaaaacggaagtcttctg
ttcggaacgattgattcatggctcatctggaaaatgtccggaggggcggcgcacgtaacg
gattattccaacgcttcaagaacgctgatgtttaatatacatgaattaaaatgggatgac
gagctgcttgatattttaggcgtgccgaaatcaatgctgccggaagtgaaaccgtcttct
catgtgtacgcgaaaacggttgattatcatttcttcggtaaaaacattccgattgcggga
gcggccggagaccagcagtctgcgctgttcggtcaggcgtgctttgaagaaggcatgggg
aaaaacacatacggcacaggctgctttatgctgatgaataccggagaaaaagccatcact
tctgatcacggccttctgacgacaatcgcctggggattagacggaaaagtcgagtatgca
ctggaaggaagcatctttgtcgcaggttctgctatccaatggctgagagacggcatgcgg
atgttccaagattcaaaagaaagcgagacatacgcagagcgtgtggattccgctgacggt
gtttatgtcgtgcccgctttcgtcggattaggcacaccgtactgggacagtgacgtgcgc
ggctcagttttcggcctgacacgcggaacgacgaaggagcattttatccgggctacgctt
gaatctctcgcttatcaggcgaaagatgtgcttgatgccatggaggctgattcaggcatc
tctttaaaaacattgcgtgtagacggcggagcggtaaaaaataacttcctcatgcagttc
caaagcgacttgcttgatgtgccggtcgaacgtccggaaattaatgaaacgacggcgctc
ggtgccgcgtatttggccggaatcgctgtcggctactggaaggacagcactgaaatcgct
gatcaatggaaccttgataagcaattcaaaccggaaatggaagatgaaaaacgcgatgaa
ttgtacggcggatggaaaaaagcagtaaatgcagctatggcttttaaataa

DBGET integrated database retrieval system