KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_04990Help
Entry
B938_04990        CDS       T02382                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B938_04990
Enzymes [BR:bamp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     B938_04990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1023992..1025425
Genome map
AA seq 477 aa AA seqDB search
MSGDKKHLVIIGGGITGLAAAFYMEKEIKEKQLPLEVTLIEAGPRAGGKIQTQHKDGYII
ERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNETLHPMPKGAVMGIPTKIAP
FISTGLFSVPGKARAALDFVLPASKPKEDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDKLSLMSTFPQFYQTEQKHRSLILGMKKSRPQPSGQQLTAKKQGQFLTLTTGLQTLVEE
LEKQLTLTKVMKGTKVTHIGREEKGYSVTLDNGKVLYAEGCIVTAPHKAAAKMLSDLPAV
SCLKDMHSTSVANVALGFPEGAVKMEHEGTGFVISRNSDFSITACTWTNKKWPHAAPEGK
TLLRAYVGKAGDESIVDLSDNEIIKIVMEDLKKVMKINGEPEMTCVTRWNESMPQYHVGH
KERIKEFRDALKASYPGVYATGASFEGVGIPDCIDQGKAAVYDSLAYLFETYQPPLS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgataaaaaacatctggtcatcatcggcggcggcataacgggattagccgcc
gccttctacatggaaaaagaaatcaaggaaaaacagctgccgcttgaggtcaccctgatt
gaagcgggcccgagagcgggcggcaaaattcagacgcagcataaagacggctacatcatt
gagcgggggccggattcttttttggaaaggaaaaaaagcgcgccgcagctcgtcaaggat
ttggggcttgagcatctgctcgtcaacaatgcgaccggccagtcttacgtgctcgtcaac
gagacgctccatccgatgccgaagggcgcggttatgggcattccgaccaaaatcgctccg
ttcatctccaccggtttattttctgttcccggaaaggcgcgggcggcgcttgactttgtc
ctgcctgcgagcaaaccgaaggaagatcagtctctgggtgaatttttccgcagacgcgtc
ggtgacgaagtcgttgagaatttaatagaaccgctattatcagggatttatgccggagat
attgataagctgagcctcatgtccacgtttccgcaattctatcagactgagcagaagcac
agaagcctgattctcggcatgaaaaaatcgcgtccgcagccttcgggacagcagctgaca
gccaaaaagcagggccagtttttaacgctgacgacagggcttcaaacgttggtggaggag
ctggaaaagcagcttacgctgacaaaggtgatgaaaggaacgaaagtcacccatatcggc
cgcgaggagaaaggatattctgtgacgcttgataacggcaaagtgctctatgcggaagga
tgcatagtaacagccccgcataaagccgcggcgaaaatgctttctgatctgccggcggtt
tcatgtcttaaagacatgcattctacgtccgttgccaacgtcgctttaggttttcctgag
ggagccgtcaagatggagcatgaaggtacgggattcgttatctcaagaaacagcgacttc
tccatcacggcctgcacatggacgaataaaaaatggccgcacgcggcgccggagggcaaa
acgcttctcagggcgtacgtcggaaaggccggagatgaatccatcgtagatctttcagat
aacgagatcattaaaatcgtaatggaagatttgaaaaaagtaatgaaaataaatggtgaa
ccggaaatgacctgtgtgacccgctggaacgaaagcatgccgcaataccatgtcggccat
aaggagcgcatcaaagagttcagagatgcgctgaaagcttcctatccgggcgtatacgcg
acgggcgcgtctttcgaaggggtgggcatccccgactgtatcgaccagggaaaagccgcc
gtatacgattcactggcttatttatttgaaacgtaccagcctccgttatcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system