KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_04990Help
Entry
B938_04990        CDS       T02382                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bamp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1023992..1025425
Genome map
AA seq 477 aa AA seqDB search
MSGDKKHLVIIGGGITGLAAAFYMEKEIKEKQLPLEVTLIEAGPRAGGKIQTQHKDGYII
ERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNETLHPMPKGAVMGIPTKIAP
FISTGLFSVPGKARAALDFVLPASKPKEDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDKLSLMSTFPQFYQTEQKHRSLILGMKKSRPQPSGQQLTAKKQGQFLTLTTGLQTLVEE
LEKQLTLTKVMKGTKVTHIGREEKGYSVTLDNGKVLYAEGCIVTAPHKAAAKMLSDLPAV
SCLKDMHSTSVANVALGFPEGAVKMEHEGTGFVISRNSDFSITACTWTNKKWPHAAPEGK
TLLRAYVGKAGDESIVDLSDNEIIKIVMEDLKKVMKINGEPEMTCVTRWNESMPQYHVGH
KERIKEFRDALKASYPGVYATGASFEGVGIPDCIDQGKAAVYDSLAYLFETYQPPLS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgataaaaaacatctggtcatcatcggcggcggcataacgggattagccgcc
gccttctacatggaaaaagaaatcaaggaaaaacagctgccgcttgaggtcaccctgatt
gaagcgggcccgagagcgggcggcaaaattcagacgcagcataaagacggctacatcatt
gagcgggggccggattcttttttggaaaggaaaaaaagcgcgccgcagctcgtcaaggat
ttggggcttgagcatctgctcgtcaacaatgcgaccggccagtcttacgtgctcgtcaac
gagacgctccatccgatgccgaagggcgcggttatgggcattccgaccaaaatcgctccg
ttcatctccaccggtttattttctgttcccggaaaggcgcgggcggcgcttgactttgtc
ctgcctgcgagcaaaccgaaggaagatcagtctctgggtgaatttttccgcagacgcgtc
ggtgacgaagtcgttgagaatttaatagaaccgctattatcagggatttatgccggagat
attgataagctgagcctcatgtccacgtttccgcaattctatcagactgagcagaagcac
agaagcctgattctcggcatgaaaaaatcgcgtccgcagccttcgggacagcagctgaca
gccaaaaagcagggccagtttttaacgctgacgacagggcttcaaacgttggtggaggag
ctggaaaagcagcttacgctgacaaaggtgatgaaaggaacgaaagtcacccatatcggc
cgcgaggagaaaggatattctgtgacgcttgataacggcaaagtgctctatgcggaagga
tgcatagtaacagccccgcataaagccgcggcgaaaatgctttctgatctgccggcggtt
tcatgtcttaaagacatgcattctacgtccgttgccaacgtcgctttaggttttcctgag
ggagccgtcaagatggagcatgaaggtacgggattcgttatctcaagaaacagcgacttc
tccatcacggcctgcacatggacgaataaaaaatggccgcacgcggcgccggagggcaaa
acgcttctcagggcgtacgtcggaaaggccggagatgaatccatcgtagatctttcagat
aacgagatcattaaaatcgtaatggaagatttgaaaaaagtaatgaaaataaatggtgaa
ccggaaatgacctgtgtgacccgctggaacgaaagcatgccgcaataccatgtcggccat
aaggagcgcatcaaagagttcagagatgcgctgaaagcttcctatccgggcgtatacgcg
acgggcgcgtctttcgaaggggtgggcatccccgactgtatcgaccagggaaaagccgcc
gtatacgattcactggcttatttatttgaaacgtaccagcctccgttatcgtaa

DBGET integrated database retrieval system