KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_07630Help
Entry
B938_07630        CDS       T02382                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bamp00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bamp00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bamp00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1527973..1528902
Genome map
AA seq 309 aa AA seqDB search
MVCRHYQELDALVQEAKKRTEEGKVADYIPALAESEQDSLSVTIYHAENTCLTAGDADRT
FTLQSISKVLSLALVLMDYGKEKVFSCVGQEPTGDPFNSMIKLETVNPGKPLNPMINAGA
LIVTGFIKGHSPKDRLDYLLGFIRRLANNQDITYCRHVAESEFSSSMINRAMCYYMKQYD
IFKGDVEEVMDLYTKQCAIKMSSLDLAKIGCVFALDGKHPETGEQVIKKDVARICKTFMV
TCGMYNASGEFAIKVGIPAKSGVSGGIMGISPYNFGIGIFGPALDEKGNSIAGVKLLEIM
SEKYRLSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtatgccggcattaccaagagctggacgcattagttcaagaagcgaaaaaaaggacc
gaagaaggcaaagtggcagactatattccggctctggctgaatctgaacaagacagcctt
tcggtcacaatttatcatgcggaaaatacatgtctgacggcaggagacgccgaccggaca
tttacgctgcagagcatttcgaaagtgctttctctggcgctcgtactgatggattacgga
aaggaaaaggtgttcagctgcgtgggtcaggagccgaccggcgacccgtttaattccatg
attaagcttgaaacagtgaatccgggcaagcctttaaatccgatgattaatgcgggagct
ctcatcgttacgggtttcattaaagggcattcgccgaaagaccgcctggattacctgctc
ggattcatcagaagacttgcgaataatcaggacattacatattgcagacatgtcgcggaa
tcggaattcagttcatccatgattaatcgggccatgtgttattacatgaagcagtatgac
atttttaaaggcgatgttgaagaggtcatggatttgtatacaaaacagtgcgcgattaag
atgagcagtctggatttagccaaaatcggctgtgtattcgcccttgacggcaagcatccg
gaaaccggggagcaggtcattaaaaaagatgtggcgagaatctgcaagacgtttatggtg
acatgcggcatgtacaatgcgagcggggaattcgcgattaaggtcggcattcccgctaaa
agcggcgtttcgggagggatcatgggcatttcgccgtacaacttcggaatcggtatattc
ggcccggcgcttgatgaaaaaggcaacagcatcgcgggtgtgaagcttttggaaatcatg
tctgagaaatacaggctgagtattttttga

DBGET integrated database retrieval system