KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_08265Help
Entry
B938_08265        CDS       T02382                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B938_08265 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B938_08265 (sucC)
   00640 Propanoate metabolism
    B938_08265 (sucC)
   00660 C5-Branched dibasic acid metabolism
    B938_08265 (sucC)
Enzymes [BR:bamp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     B938_08265 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1655532..1656689
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVEKAESLSSSVYVVKAQIHAGGRGKAGGV
KIAKTKDEVKEYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYVGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATRQVGLTLPLVVRLEGTNVDLGKKI
LNESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccagggaaaagaagtcctcagaaaatacggggtgtctgttcct
gaaggtaaagtggcttttacagcagaggaagcagttgaaaaagcagagagcctgtcaagc
tcggtttatgtcgtaaaggcgcaaatccatgctggcggccgcggcaaagctggtggggta
aagattgcaaaaacaaaagatgaagtgaaagagtatgccgaagaactgttaggcaagacg
ctcgtcacacatcaaacgggtccggacggacaagtaataaaacgcttacttattgaagaa
ggctgcgatattaaaaaggaatactatgtcgggcttgtacttgaccgtgctacttcaaga
atcgttttaatggcgtctgaagaaggcggaacggagattgaagaagtagcggaaaaaaca
cctgaaaaaattaaaaaagcggtaattgatccggctgtcggccttcagggctatcaggca
agggaaattgcattcgcaattaacatcccgaaagagcttgtcggcaaagccgctaaattt
atgctcggtttatataaagcatttgttgagaaggactgctccatcgccgagatcaaccct
ctcgtcgttacgggggacggaaacgtcatggcgctggatgctaagctgaacttcgacagc
aatgcgttatacagacaaaaagacattatggaatacagagatttagatgaagaagatccg
aaagaaatcgaagcgtcaaaatacgatttaagctacatttcccttgatggaaatatcggc
tgtatggtaaacggcgcgggtcttgcaatgtctactatggatatcattaaacactacggc
ggagaacctgcaaacttccttgatgtcgggggcggcgcaaccgcagaaaaagttacggaa
gcttttaaaatcattctttccgatcaaaacgtaaaaggaattttcgtcaatattttcgga
ggcatcatgaagtgtgatgtcatcgccgagggcgttgttgaagcgacgagacaagtcgga
ttgacattgccgctggtcgtgcgccttgaagggacaaacgtagatttaggaaagaaaatc
ctgaatgaatcaggcttaaacatcacatctgcggaatcaatggcagacggcgcacagaaa
atagtatccttagtttag

DBGET integrated database retrieval system