KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_08440Help
Entry
B938_08440        CDS       T02382                                 

Definition
chemotaxis-specific protein-glutamate methyltransferase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B938_08440
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    B938_08440
Enzymes [BR:bamp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     B938_08440
Two-component system [BR:bamp02022]
 CheA family
  CheA-CheYBV
   B938_08440
Bacterial motility proteins [BR:bamp02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    B938_08440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1686672..1687739
Genome map
AA seq 355 aa AA seqDB search
MIRVLVVDDSAFMRKMITDFLAAEVQIEVIGTARNGEEALKKIELLKPDVVTLDIEMPVM
NGTDTLRKIISIYKLPVIMVSSQTQQGKDQTINCLEMGAFDFITKPSGAISLDLYKIKEQ
LIERVIAAGLSCAQKPEAAVKESSIPERPALAGFERPKAKSAKQAVFIATSTGGPRALQK
VIPKLPKDLKAPVFVVQHMPEGFTASLADRLNHLSDIQVKEAENGEEAKDGWVYIAPGGK
NMTVAEEGGRLRIILDVHDTESRHKPSADYLFRSASRLSDYEKVAVIMTGMGSDGTEGVK
EMLRTGGVKTIAESDESCVVFGMPKSAIKAGLIHEIKHVEDIAASITGCVKKERV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgattcgtgtgcttgtcgttgatgactcagcttttatgagaaagatgattaccgatttt
ctggctgcggaagtgcagatagaagtcatcgggacagccagaaacggggaagaggcgctg
aagaaaatagagcttctcaagcctgatgttgtcacgcttgatattgaaatgccggtcatg
aacggaacggacacattgcggaagatcatcagcatatataaacttcccgtaatcatggta
tcgagccagacacagcaagggaaggaccaaacgatcaactgtctggaaatgggcgctttt
gattttatcaccaagccttccggagcgatttcacttgatctttataaaattaaagagcag
ctgattgagagggtgattgcagccgggctgtcctgcgcacaaaaacctgaggcggcagtg
aaagagtcttctatcccggaacgtccggctttggcgggatttgaaagaccgaaagcaaaa
tccgccaagcaggccgtattcatcgcgacctctacaggcggaccgcgggctctgcaaaag
gtgattccgaaactgccgaaggatttaaaggcgcctgtatttgtcgttcagcacatgcct
gaaggcttcaccgcttcacttgcagacagactcaaccatttgtcagatattcaggtcaaa
gaagcggaaaacggtgaagaagcgaaagacggatgggtgtacatcgcgcccggcggaaaa
aatatgacggttgcagaggaaggcggaaggctccgcatcattcttgacgttcatgatacg
gaaagccggcataaaccgtcagccgattatttgtttcggtcggcaagccgcttatccgat
tacgaaaaggtagccgtcattatgaccggcatgggcagcgacggaaccgagggcgtaaaa
gaaatgctcagaacaggcggcgttaaaacgattgcggaatcggacgaatcctgtgttgtg
ttcggaatgccgaagtcagcgataaaggcgggcctcattcatgagattaaacatgtggaa
gatatcgcggcatccatcaccggatgtgtgaaaaaagagagggtgtga

DBGET integrated database retrieval system