KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_08505Help
Entry
B938_08505        CDS       T02382                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bamp00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1697745..1698896
Genome map
AA seq 383 aa AA seqDB search
MKNICLLGATGSIGEQTLDVLRMHQDQFRLVSMTFGKNAEKAIPLIRTFQPKYVAVGDMD
TYQKVKEASFSHECQIGIGEEGLIEAAVMDEVDIVVNALLGSVGLIPTLKAIEQKKTIAL
ANKETLVTAGHIVKGHAKRYGVPLLPVDSEHSAIFQALQGEQSKNIERLVITASGGSFRD
KTRQELESVTIADALNHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYEQIDVVLHK
ESIIHSMVEFHDRSVIAQLGNPDMRVPIQYALTYPDRLPLPETKRLELWEIGNLHFAKAD
FERFRCLQFAFESGKIGGTMPTVLNAANEEAVAAFLAGRISFLSIEDLIEKALDRHSVIQ
DPSLADIQEVDKDTRGYVNSILT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaatatttgtcttttaggagcaacaggatcaataggggagcagacgttagacgta
ttgcgcatgcatcaagatcagttccgtctcgtctcgatgactttcggtaaaaacgccgag
aaagcgatcccgttgatcagaacgtttcagccgaaatatgtagcagtcggcgacatggat
acataccaaaaagtgaaagaagcgtctttttctcatgaatgtcaaatcggcattggagaa
gaaggcctgattgaagcggcagtcatggacgaagtcgatatcgtggtcaatgcgctgctt
ggaagcgtcggtttaatcccgactttgaaagcgattgaacagaaaaaaacaattgcgctt
gcaaataaggaaactctcgtcactgccgggcatatagtgaaaggacacgcaaaacgatac
ggtgttcctcttcttccggtcgacagcgaacattccgctattttccaggcgctgcaaggc
gaacagagcaaaaatatcgagcgcctggtcattacggcatccggcggcagtttcagagat
aaaacacggcaggagcttgagtctgtaacgattgccgacgcccttaaccacccgaactgg
tcgatgggtgcaaaaattacgattgactcggctacaatgatgaataaaggacttgaagtc
attgaggcgcattggctgtttgacattccgtatgaacagattgacgttgtattacataag
gagagcatcattcattcgatggttgaatttcacgacagaagcgtcatcgcccagctcgga
aatccggacatgagggtgccgattcaatatgcgctgacatatccggaccgtctgcctctg
cctgaaactaaaaggcttgaattatgggagatcggaaacctccattttgcgaaagctgac
tttgaaaggttccgctgcttacaatttgcctttgaatcaggtaaaatagggggaacgatg
ccgacggttttaaatgcggccaacgaagaagccgttgccgcttttcttgccggacggatt
tcattcttatcgattgaggacctgattgaaaaagcattggaccgccacagcgtaattcag
gatccgagtcttgcggatatccaagaagtggacaaagacacccggggatacgttaattca
atactcacataa

DBGET integrated database retrieval system