KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_08995Help
Entry
B938_08995        CDS       T02382                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B938_08995
   00051 Fructose and mannose metabolism
    B938_08995
Enzymes [BR:bamp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     B938_08995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1860980..1862317
Genome map
AA seq 445 aa AA seqDB search
MAHSHSGSVNYFESANKVIYEGKESTNPLAFKYYNSQEVIGGKTMKEHLRFSIAYWHTFT
ADGTDIFGAATMQRPWDHYKGMDLARARVDAAFELFEKLDAPFFAFHDRDIAPEGSTLKE
TNQNLDLIVDMIKDYMRTSGVKLLWNTANMFTNPRFVHGAATSCNADVFAYAAAQVKKGL
ETAKELGAENYVFWGGREGYETLLNTDLKFELDNMARFMHMAVDYAKEIGYTGQFLIEPK
PKEPTTHQYDTDAATTIAFLKQYGLDNHFKLNLEANHATLAGHTFEHELRMARVHGLLGS
VDANQGDPLLGWDTDEFPTDLYSATLAMYEILQNGGLGSGGLNFDAKVRRSSFEPDDLLY
AHVAGMDTFARGLKAAHKLIEDRVFEDVIQHRYRSFTEGIGLEIAEGRADFKTLEQYALN
NQPIKNESGRQERLKAILNQYILQV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctcactctcattccggttcggtcaactattttgaaagcgcaaacaaagtgatttac
gaagggaaagaatccacgaatcctttagcatttaaatactataattctcaagaagtaatt
ggcggaaaaacgatgaaagagcatttgcgattttctattgcctattggcatacatttacc
gctgacggcacagacatttttggcgcagctacgatgcagagaccgtgggatcactataaa
ggcatggatctggcgagagcgagggtagatgcagcgtttgagctgtttgaaaaactggat
gcgccattttttgcttttcatgaccgggatatcgcaccggaaggaagtacgttaaaagag
acaaatcaaaatctggatttaatcgtggatatgataaaagactacatgagaaccagcggc
gttaagttattatggaatactgcaaacatgtttacgaatccccgtttcgtccatggtgcg
gcgacttcttgtaacgcagatgtatttgcgtatgccgcagcccaagtaaaaaaaggatta
gaaacagcaaaagagcttggcgccgagaactatgtattttggggcggacgtgaagggtac
gaaactttgttaaataccgatttaaaatttgagcttgataatatggccagatttatgcat
atggcagtggattatgcgaaggaaatcgggtatacagggcagtttttgattgaaccaaaa
ccaaaagagccgactacccatcaatatgatacggacgcagcaacaaccattgccttttta
aagcaatatggcttagacaatcattttaaattaaatctcgaagccaatcatgccacatta
gccgggcatacattcgaacatgaattacgcatggcgagagtgcatggccttcttggctct
gttgacgcgaatcagggtgatccgcttttaggctgggacacagatgaatttccgacagat
ttatattctgcgacattagcaatgtacgaaattctgcaaaatggcggtcttggaagcgga
ggattaaactttgacgcaaaggtcaggagatcttcttttgagcctgatgatttactatat
gcccatgttgcagggatggatacatttgcaagagggttgaaagccgcccacaaattaatc
gaagatcgtgtgtttgaagatgtgattcaacaccgttaccgcagctttactgaagggatt
ggtcttgaaattgcagaaggaagagctgattttaaaacacttgagcaatatgcgctgaac
aatcagccaattaaaaacgaatcagggagacaggagcggttaaaagcgatattaaatcaa
tacattttacaggtataa

DBGET integrated database retrieval system