KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_09365Help
Entry
B938_09365        CDS       T02382                                 

Definition
protein BglC
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B938_09365
Enzymes [BR:bamp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     B938_09365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1924981..1926480)
Genome map
AA seq 499 aa AA seqDB search
MKRSISIFITCLLIAVLTMGGLLHSPASAAGTKTPVAKNGQLSLKGTQLVNRDGKAVQLK
GISSHGLQWYGDFVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDI
KPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDVADDQLKDANVMYALHFYAGTHGQFLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLNYLDSKKISWVNWNLSDKQESS
STLKPGASKTGGWPLTDLTASGTFVRENLRGTKDSTKYGPETPAQDNPTQEKGVSVQYKA
GDGRVNSNQIRPLLHIKNNGNATVDLKDVTARYWYNAKNKGQNFDCDYAQMGCGNLTHKF
VTLHKPKQGADTYLELGFKTGTLSPGASTGNIELRLHNDDWSNYAQSGDYSFFQSNTFKT
TKKITLYHQGKLIWGSEPN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtcaatttctatttttattacgtgtttattgattgcggtattgacaatgggc
ggcttgctgcattcgccggcatcagcagcagggacaaaaacgccagtagccaagaatggt
cagcttagcctaaaaggtacacaacttgtaaaccgagatggcaaagcggtacaactgaaa
gggatcagttcacatggattgcaatggtatggcgatttcgtcaataaagacagcttaaaa
tggctgagagacgattggggcatcaccgttttccgcgcggcgatgtatacggcagatggc
ggttatattgacaacccgtccgtgaaaaataaagtaaaagaagcggttgaagcggcaaaa
gaacttgggatatatgtcatcattgactggcatattttaaatgacggcaacccaaaccaa
aataaagagaaggcaaaagaatttttcaaggagatgtcaagtctttacggaaacacgcca
aacgtcatttatgaaattgcaaacgaaccaaacggtgacgtgaactggaagcgtgatatt
aaaccgtatgcggaagaagtgatttccgttatccgcaaaaatgatccagacaacatcatc
attgtcggaaccggtacatggagccaggatgtgaatgatgttgccgatgaccagttaaaa
gatgcaaacgtcatgtacgcgcttcatttttatgccggcacacatggccaatttttacgg
gataaagcaaactacgcactcagcaaaggagcgcctattttcgtgacggaatggggaaca
agcgatgcgtctggaaatggcggtgtattccttgaccagtcgcgggaatggctgaattat
ctcgacagcaagaaaatcagctgggtgaactggaatctttctgataagcaggaatcatcc
tcaacgttaaagccaggagcatctaaaacaggcggctggccgcttacagatttaactgct
tcaggaacattcgtaagagaaaaccttcgcggtactaaagattcaacgaagtacggccct
gaaaccccagcacaagataaccccacacaggaaaaaggcgtttctgtacaatacaaagca
ggggatgggcgtgtgaacagcaatcaaatccgcccgctgcttcacataaaaaataacggc
aatgcgacggttgatttaaaagatgtcactgcccgttactggtataacgcgaaaaacaaa
ggccaaaactttgactgtgactacgcgcagatgggatgcggcaatctgacccacaaattt
gtgacgctgcataaacctaagcaaggtgcagatacctatctggaactggggtttaaaaca
ggaacgctgtcaccgggagcaagcacagggaatattgagcttcgtcttcacaatgatgac
tggagcaattatgcacaaagcggcgattattcctttttccaatcaaatacgtttaaaaca
acgaaaaaaatcacattatatcatcaaggaaaactgatttggggatcagaacccaattaa

DBGET integrated database retrieval system