KEGG   Bacillus velezensis AS43.3: B938_09470Help
Entry
B938_09470        CDS       T02382                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bamp  Bacillus velezensis AS43.3
Pathway
bamp00040  Pentose and glucuronate interconversions
bamp00052  Galactose metabolism
bamp00500  Starch and sucrose metabolism
bamp00520  Amino sugar and nucleotide sugar metabolism
bamp01100  Metabolic pathways
bamp01130  Biosynthesis of antibiotics
Module
bamp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B938_09470
   00052 Galactose metabolism
    B938_09470
   00500 Starch and sucrose metabolism
    B938_09470
   00520 Amino sugar and nucleotide sugar metabolism
    B938_09470
Enzymes [BR:bamp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     B938_09470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: AFZ90914
Position
1981344..1982234
Genome map
AA seq 296 aa AA seqDB search
MRKVRKAVIPAAGLGTRFLPATKAQPKEMMPIVDKPAIQYIVEEAAASGIEDILIITGRN
KRSIEDHFDRSAELEFNLQEKGKTETLKEMQRIADLANIHYLRQKEPLGLGHAVLCAEHF
IGDEPFAVLLGDDIMVSDTPALSQLIDVYNQHGTETVGVQPVDPADVSKYGIIQTGRQGG
HVYQVEDLIEKPAVEKAPSHIAVMGRYILTPAIFKTLKTIGRGAGNEIQLTDALREVCRT
RSIYARELEGSRFDIGDKFGCFKAGTEIGLLREEMRPKLLAYLEEVLKRESEEIVR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagtgagaaaagcggtcattcccgcagcaggtttaggaacgagatttctgccg
gcgacaaaggcgcagccgaaagaaatgatgccgattgtcgacaaaccggctatccaatat
attgtcgaagaggccgcagcgtcaggaattgaagatatattgattattacagggagaaac
aaacgctcgattgaagatcattttgaccggtcggcggaattggaattcaatctgcaggaa
aaaggcaagacggagacgctgaaggaaatgcagcggattgccgatttggccaatattcat
tacctccgtcagaaagaaccgctcggattaggacatgcggtgctgtgtgcggagcatttt
atcggagatgagccttttgccgttctcttaggtgatgatattatggtatctgatactccc
gctctttcacagctcatagacgtctataaccaacacggcacagaaacggtcggcgtacag
cccgtcgatcctgctgatgtcagcaaatatggtattatacagacggggcggcagggcggt
catgtgtaccaggttgaggatctgattgagaaaccggctgttgaaaaggcgccctctcat
attgccgtgatgggccgctacatattaacccctgctatttttaaaacgctgaagacgatc
ggaagaggcgcgggcaacgaaatccaattgacagacgcgctgcgcgaagtgtgccgcacc
cgaagcatttacgcgcgggagcttgaaggaagccggtttgatataggagataagttcggc
tgttttaaggccggcacggagatcgggcttctgcgggaagaaatgagaccgaaactttta
gcttatttagaagaggtgttaaaaagagaatctgaagaaatcgtgcgttaa

DBGET integrated database retrieval system