KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_10025Help
Entry
B938_10025        CDS       T02382                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bamp00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bamp00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2115342..2116811)
Genome map
AA seq 489 aa AA seqDB search
MFFKKGLHITLVFLMFFFFISSSMETEVYAADRKASDKNKVRVWFSSEKDPASRTWYDGP
LEVKYALDEQTPLTLTKKKASDSAAVYIDPSRRYQSVLGVGSSLEESTIHNLSKMTPAKR
KEVLKKLVDPKDGIGMDVMRITIGTSDFTAQEFYTYDDMPEGQTDPKLRHFSIQKDIDLH
ITATIKEALAINPELKIIASPWSPPAWMKTNENLKRGKLKDKYIGALAVYFRKFIEAYEK
QGIPIYAMTLQNEPLLEIDYPSMYMPQSQQRKLALALKKEMKKHVIDTKIWIYDHNASGA
WNYIPPILDDKKGNRAADGIAFHDYDGDLSVMSEIGKRYPDQSIHLTERSVWGTAGADRI
AQYFRNGASSYNAWVTMLDSQIKTHHWIGTPDPTLFIQDAKNPDRYWNIPIFHMTGNFSK
FIDRGAKRIESNYGSKNTVSNVSFLNPDQSIVTVIINQTSADQKFHVVSENRQFEAVIPA
KTVATYKWK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaaaaaaggtctgcacataacgctggtttttcttatgtttttctttttcata
tcaagcagcatggaaaccgaagtgtatgcagctgatcggaaggcttcagacaaaaacaaa
gtaagggtgtggttcagttctgaaaaagatccggcttcccgtacgtggtatgacgggccg
ctggaagtgaaatacgccttagacgaacaaacaccgcttacattgacaaaaaagaaggct
tctgactccgccgctgtgtatattgatccgtcgcgccgctatcaaagtgtgttaggcgta
ggatcgtccctggaagaatccacaatccataatttatcaaaaatgacacccgcaaaaaga
aaagaagtgctgaaaaaactcgttgatcccaaagatggtatcggaatggacgttatgcgc
ataacgatcgggacatctgattttacggcacaggaattttatacgtatgacgatatgcct
gaaggccaaacagatcctaagctccgtcatttctcgatccaaaaggatattgatttacac
attacagcaaccatcaaggaagcgctggcgataaatccggaactaaaaatcattgcctca
ccgtggagcccgccggcttggatgaaaacgaatgaaaacctcaagcggggaaagctgaaa
gataaatatatcggcgcactggccgtttacttccgcaaatttattgaggcgtacgaaaag
cagggaattccgatttatgcgatgacccttcaaaatgaacctttgctggaaatcgactat
ccgagcatgtatatgccgcagtctcagcagcgtaaactggcactggccttaaaaaaagaa
atgaaaaaacacgtaattgacacgaaaatttggatttatgatcacaatgcgagcggggcg
tggaactatattccgccgattttagatgataaaaaaggaaaccgggccgcagacggcatc
gcttttcacgattatgacggtgacctttccgtcatgtcggaaatcggaaagagatatcct
gatcaatctattcacttaacggagcggtctgtctgggggacggcaggggcggaccggatc
gcgcagtatttccgcaacggcgcgtcgagctacaatgcgtgggtgacgatgctcgacagt
caaatcaagacgcatcattggataggcaccccagacccgacgctgtttattcaggatgct
aaaaaccctgaccgctattggaatatcccgatctttcatatgacaggcaacttttcaaaa
tttatcgaccggggagcaaagcggatagaaagtaattacggctccaaaaacacagtctcg
aatgtatcgttccttaatcctgatcaatccattgtgacagtcataatcaaccagacatcc
gccgatcaaaaattccatgtcgtttcagaaaatcggcagtttgaagctgtcatcccggct
aaaaccgtggctacctacaaatggaagtga

DBGET integrated database retrieval system