KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_10755Help
Entry
B938_10755        CDS       T02382                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bamp01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bamp00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2237820..2238572)
Genome map
AA seq 250 aa AA seqDB search
MLDQIIQQKKEEIKSIVLPETCQIERRSFKKALLNPNRFIGLIAEVKKASPSKGLIKEHF
VPETIAADYEAAKADALSVLTDTRFFQGRNQFLTDVKQTVSLPVLRKDFIIDSLQVEESF
RIGADAILLIGEALEPSELHELYLEAREKGMDVLVEVHDETVLERILQVFQPDILGINNR
DLKTFRTSVSQTEKIAQLVPDGCLLVSESGIGSLADLQFVNKHGAQAVLVGESLMREDSQ
QKAIRGLFGE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatcaaatcattcagcagaaaaaagaagaaatcaaatccatcgtgctgccggaa
acctgtcaaattgaacggagatcctttaaaaaagcgctcctgaacccgaaccgttttatc
gggctgattgccgaagtgaaaaaagcttcgccgtctaaaggattgattaaagagcatttt
gttccggaaacgattgcggcggattatgaagcggctaaagccgacgccctttcagttctc
acggatacccgtttttttcaggggagaaatcaatttctgacagatgttaaacaaaccgtg
tctcttcccgtgctgagaaaagattttattattgattcccttcaggtggaggaatcgttc
aggatcggcgccgatgccattttgctgatcggggaagcgctggaaccttcagagcttcat
gagctttatctggaagcccgcgagaagggcatggacgttctcgttgaagtccatgatgaa
actgtgcttgaacggattttacaagtgtttcagccggacattctcggcataaacaaccgg
gacttaaaaacgttccgtacttctgtttcgcaaacggaaaaaatagcgcagcttgtaccg
gacggctgtctgctggtcagcgaaagcggcatcggttctttggctgacctgcaattcgtc
aacaagcacggggcgcaggctgtattggtcggagaatccttaatgagagaggattcgcag
caaaaggcgatccgcggactgttcggggagtga

DBGET integrated database retrieval system