KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_12535Help
Entry
B938_12535        CDS       T02382                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    B938_12535
  Amino acid metabolism
   00380 Tryptophan metabolism
    B938_12535
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    B938_12535
Enzymes [BR:bamp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     B938_12535
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     B938_12535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2598550..2601711)
Genome map
AA seq 1053 aa AA seqDB search
MKQLSAIPQPKTYGPLKNLPHLEKEKLSQSLWKIAEEYGPIFRFEFPSSVGVFVSGRELA
AEVCDEKRFDKNLSKALLKVREFGGDGLFTSWTHEKNWQKAHRILLPSFSQKAMKGYHSM
MLDIAMQLVQKWSRLNPNEEIDVAEDMTRLTLDTIGLCGFHYRFNSFYRDTQHPFITSML
RALQEAMRQSQRHSLQDKLMIKTRHQFQQDIEEMNSLVDRIIAERRENPDENLSDLLALM
LEAKDPVTGERLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLKNKDKLKKAVQEAERV
LTGETPEYKKIQQLTYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGKYPIAKGQPVTILT
PQLHRDKSAWGEDAESFRPERFSDPAAIPADAYKPFGNGQRACIGMQFALQEATMVLGLV
LKHFELIDHTDYELTIKEALTIKPGDFKIRVKNKDVSNHQPVQNHKAEGSGHKEETKEIP
SHGTPLLILYGSNLGTAEGIAEELADIGRSKGFSTETGPLDDYAGKLPVKGAVVIVTASY
NGAPPDNAAGFVKWMETLEDQELKGVSYAVFGCGDRNWAATYQRIPRLIDKVLEEKGAKR
LTSIGEGDNADDFEYSQEAWEDSFWKDIMKAFHIEAAPKQTNKSQLSIEYVSEAAETPIA
KTYKAFEAEVITNKELHTESSKRSVRHIELRLPETETYQEGDHLGVLPQNSGELISRVIR
RFGLDPNQHFKIKGRQLPHLPMDRPVNAPELLASYVELQEPATRAQLRELAAHTVCPPHQ
KELEHLYSDDAAYKENVLKKRMTMLDLLEDYPACELPFERFLELLPSLKARYYSISSSPK
ATSGELSITVGVVTAPAWSGRGEYRGVASNYLAGLQKGDSAVCFIRSPQSGFALPENPKT
PLIMVGAGTGIAPFRGFIQARAAEKMSGNSLGEAHLYFGCRHPEEDDLYKDEFDHAEKNG
LVTVHRAYSRLDQDCKVYVQDVLLREAAQIIALLDQGGHLYICGDGSKMAPAVENVLLQA
YEKVHNTDSKVSLEWLEQLQAEGRYAKDVWAGM
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagctaagcgctataccgcagccgaaaacatacgggcctctgaaaaatctccct
cacttggaaaaagaaaaactgtcacaatcgctttggaaaattgccgaagaatacggcccg
atctttcgttttgaatttccgagctctgtcggggtcttcgtatcaggccgcgagctcgcg
gcagaagtctgcgatgaaaagcgatttgacaaaaatctcagcaaagctttgctgaaggtc
cgtgagtttggcggtgacggactatttacgagctggactcacgaaaagaattggcagaaa
gcgcatcggattttattgccgagcttcagccagaaggcgatgaaaggctatcattcaatg
atgctggatattgccatgcagctcgtgcagaagtggagcagattaaatccgaatgaagaa
attgacgttgccgaagatatgacgcgcctgacgctggatacaatcggcctgtgcggattt
cattaccgctttaacagcttttaccgcgacacacagcatccttttatcacaagtatgctt
cgtgcgctgcaggaggcaatgcgccaatcgcagagacacagcctgcaggacaagctgatg
atcaaaacgagacatcagttccagcaggatattgaagagatgaattcgcttgtagaccgg
atcatcgctgagcggagggaaaatccggatgagaatctgtctgaccttttagcattgatg
cttgaagcgaaagaccctgtaacgggggaaaggctggatgatgaaaatatccgttatcaa
atcattacctttttgatcgctgggcatgaaaccacaagcgggctgctttcttttgcgata
tactgcctgctgaaaaataaagataaattgaaaaaagccgttcaggaagccgagcgggtg
ttgacgggagagacccctgaatataagaagattcagcagctgacatatatccgcatggtg
ctaaacgagactttgcggctgtatccgactgccccggcattttctctgtacgcgaaagaa
gatacggttctcggcgggaaatatccgattgcgaagggacagccggtgacgattctgact
ccgcagctgcatcgggataaaagcgcgtggggagaagatgccgagtcattccgtccggaa
aggttcagtgatcccgcggcaattccggcagatgcgtataagccgttcggaaacggacag
cgcgcatgcatcgggatgcagtttgccctgcaggaagcgacaatggtgctcggccttgtc
ctgaaacactttgaactgattgatcatactgattatgagcttacgattaaagaagctcta
accattaagcccggtgattttaaaatccgtgtgaaaaacaaggacgtgtccaatcatcag
cccgtacaaaaccataaagctgaaggcagcggtcacaaagaagaaacgaaagaaatcccg
tcccacggaacgccgcttctcattctttacggttcaaatttgggaactgcggaaggaatc
gcggaagagctggctgatatcggaagaagcaaaggattttcaactgaaaccggcccgctc
gatgattatgccgggaaactgcctgtaaaaggcgcggtcgttattgttacggcttcttat
aacggggcgccgcctgataatgcggcgggttttgtgaaatggatggaaacccttgaagat
caggaattaaagggtgtttcttacgccgtcttcggctgcggagaccgcaactgggccgcc
acttaccaaaggatcccccgcctgatagacaaagtgcttgaagaaaaaggggcaaaacgg
ctgacctctatcggggagggcgacaatgccgatgattttgagtacagtcaggaagcctgg
gaagactcattctggaaggacatcatgaaggcttttcatatagaggccgctccaaaacag
acaaacaaatcacagttatcaatcgaatacgtaagtgaagcagccgagacgccgattgcc
aaaacgtacaaagcatttgaggcggaggtcatcacgaacaaagagcttcataccgaaagc
agcaagcgctcagtccggcatattgagctgcgtctccccgaaacagaaacgtatcaggaa
ggagatcatctcggggtgcttccgcaaaacagcggggaactgatcagccgtgtcattcgc
cgattcggtcttgatccgaaccagcactttaagatcaagggccggcagctgcctcatctg
ccgatggaccggccggttaatgcgccggagcttttggcgtcctatgtagagctgcaggag
ccggcaacgagagcccagcttcgcgaacttgccgcacataccgtgtgcccgccgcaccaa
aaagaattggagcatctttattctgatgatgcggcatataaagaaaacgtgctgaaaaaa
cgaatgaccatgctggacctgctggaagattatcctgcatgtgaactgccgtttgagcgc
tttttagaacttctgccgtccttaaaggcgcgctattattcaatctcaagctcaccgaag
gcaaccagcggggagctcagtatcacggtcggcgttgtgacggctccggcatggagcggc
cgtggggaataccggggcgtggcttcgaactatttagccggattacaaaaaggcgattcc
gccgtctgtttcatccgctcgccgcagtcgggtttcgcattgcctgaaaatccgaaaacg
cctctcattatggtcggagcaggcacaggaattgcgccgttcaggggatttatccaggcg
cgggctgccgaaaaaatgtccggtaacagcctgggcgaagctcatttatacttcggctgc
aggcatccagaggaagacgatctgtacaaagatgaattcgaccatgcggagaaaaacggc
cttgtcaccgtgcatcgggcgtattccaggttagatcaggactgtaaagtatatgtacag
gatgttctgcttcgcgaggctgcacaaattattgcccttcttgaccaaggcggccatctc
tatatatgcggtgacggaagcaaaatggctccggctgtcgaaaatgtactgcttcaggcg
tatgaaaaggtgcataacaccgattcaaaagtttccttggagtggcttgaacagctgcag
gcggaaggaagatatgcgaaagatgtttgggcaggtatgtaa

DBGET integrated database retrieval system