KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_13230Help
Entry
B938_13230        CDS       T02382                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bamp01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bamp00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2734438..2735217)
Genome map
AA seq 259 aa AA seqDB search
MNSLSMAVEQSVAVITINHQPANALSGAVLDELSGLFDRCETDDSVRSIIIRGEGKFFSA
GADIKEFTSLENLEQSSAMADKGQQLMERIEGFPKPVIAAIHGAALGGGLELAMACHIRI
ATLDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALEMIGTSEPVSGEEALSLGLVTIGA
EHEEELLKKAKTLAGKFAEKSPQSMASLLELLYSNKIYSYDGGLKLEAKRFGEAFASDDA
KEGIQAFLEKRKPQFGGRR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcctttcgatggcggtagaacaatctgttgcggtgatcaccattaatcatcag
ccggccaacgcgctgtccggtgcggttttagacgagttgtccggtctgttcgaccggtgt
gaaacagatgacagcgtcagaagcatcatcattcgcggtgaggggaaatttttctcggcg
ggcgccgatataaaggaatttacgtcgcttgaaaatcttgagcaatcttctgccatggcg
gataaaggccagcagctgatggaaagaattgaagggtttccgaagcccgttatcgcagcg
attcacggcgctgcgctcggaggcggtcttgagctagccatggcctgccatatcagaatc
gctacattagatgcaaagctcggcctgcccgagctgaatctcggcattattccgggcttt
gccgggacgcagcggcttccccggtacgtcggtacggcgaaagcgcttgaaatgatcggc
acttcagaacctgtgtccggagaagaagcgctcagcctcgggcttgtcacgataggcgcc
gaacatgaggaagagctgctgaaaaaggcgaaaacgctcgcgggcaagtttgcggaaaaa
agcccgcagtcgatggcttctctgcttgagctcctttattcaaataagatctattcttat
gacggcggcttaaagcttgaagcaaagcgttttggggaagcatttgcatcagatgacgca
aaagaaggcattcaggcatttctcgaaaaaagaaagcctcaattcggtgggcgaagataa

DBGET integrated database retrieval system