KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_14080Help
Entry
B938_14080        CDS       T02382                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    B938_14080
  Lipid metabolism
   00561 Glycerolipid metabolism
    B938_14080
   00600 Sphingolipid metabolism
    B938_14080
Enzymes [BR:bamp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     B938_14080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2901062..2902360
Genome map
AA seq 432 aa AA seqDB search
MKKITFIGAGSTIFAKNVLGDCLLTEALNGFEFALYDIDAVRLKESQLMLENMRDRYNTS
ISIISYDDRKQALKHAGYVINAIQVGGYKPATVIDFDIPKRYGLRQTIADTVGIGGIFRS
LRTIPVLFDIAKDMEEVCPDAWLLNYTNPMASLTGAMLRHTNVKTVGLCHSVQVCTKDLF
DSLGMDHEGTEERIAGINHMAWLLEIKKDGIDLYPEIKRRAREKQKTKHKDMVRFELMDK
FGCYVTESSEHNAEYHPYFIKSRYPELIDELQIPLDEYPRRCAEQINNWETMRDGIINNQ
NLTHERSKEYGSRIIEAMETGKPFTFGGNVLNTGLIPNLPAKAVVEVPCTAVKNHIMPCY
SGELPEQLAALNRTNINTQLLTIEAAVTLKKEAVYQAAMLDPHTSAELSMNDIISLCDDL
FEAHKDRLPAYH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaattacgtttatcggagcggggagcacgattttcgcaaaaaatgtactgggg
gactgcttactgactgaagcattaaacgggtttgaattcgcgctttatgatattgacgct
gtacggctgaaagaatcccagctcatgctggaaaacatgagagaccgctacaatacgagt
atatccatcatctcctacgatgaccgaaaacaggcgctgaaacacgccggctatgtgata
aacgccattcaggtcggaggctataaacccgcgacggtcattgactttgacatcccgaag
cggtacggtctccgccagacgattgccgataccgtcggaataggcggcattttccgttcc
cttcgcaccatccccgttttatttgacatcgcaaaagacatggaagaggtctgcccggat
gcgtggctgttaaactatacaaatccgatggcctctctgaccggagcgatgctcagacat
acgaatgtcaaaacggtcggcctgtgccacagcgtccaggtatgtaccaaagatctgttt
gactcactcggcatggatcacgaaggtacggaagaacgcattgccggcattaaccatatg
gcttggcttttggagattaaaaaagacggaattgatttatatcctgaaattaaaagacgg
gcacgcgaaaaacaaaagacgaaacataaggacatggtgcggtttgagctgatggataaa
ttcggctgctacgtaacggaatcatctgagcataatgccgaatatcacccgtattttata
aaaagccggtatccggagctgatagatgaactccaaattccgcttgatgaatatccgagg
agatgcgcggaacaaatcaacaattgggaaacgatgagagacggcatcatcaacaaccaa
aacctgacgcatgaacgctcaaaagaatacggttcgagaattattgaagcgatggagacg
ggcaaaccgttcacattcggcggcaatgtgctgaataccgggctgataccgaatctgccg
gcgaaagcggtcgttgaagtgccttgcacagccgtcaaaaaccacattatgccatgctat
tcgggcgaacttcccgagcagctcgcggcgctcaacagaacaaacattaacacacagctt
ctaaccatcgaagcggccgttacattaaaaaaggaagccgtatatcaggcggccatgctt
gacccgcatacgagcgccgagctttccatgaatgacatcatatctttgtgcgatgactta
tttgaagcgcacaaagaccggcttccggcttatcactga

DBGET integrated database retrieval system