KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_14200Help
Entry
B938_14200        CDS       T02382                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bamp00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2924675..2925454)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVGTIVIIHGASEYHGRYKWLVEMWRSSGYNVVMGDLPGQGTSTRARGHIRS
FQEYIDEVDIWIDKARTLEAPVFLLGHSMGGLIAIEWFKQQRNPRITALILSSPCLGLQI
KVNKVLDFASKGLNVLAPSLRVDSGLSPDMATRNADMIEADQNDSLYVTKVSVRWYRELL
KTIDAAMVPTDAFLKVPLLLMQGGDDKIVDKMKVRKWFSGVASHNKSYREWEGLYHEIFN
EPERETVFKAAKAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacttggaaagcagacaggcccgtcggtaccattgtcattatccacggggcaagc
gaataccacggacgttataaatggctcgttgaaatgtggagatcttccggatataacgtg
gtgatgggcgatttgcccggtcagggaacgtcgacccgcgccagagggcatattcgctct
ttccaagaatacattgatgaagtagatatatggattgataaagcgagaacgcttgaagcg
cccgttttccttttgggccacagcatgggcggactgattgcgatagaatggtttaagcag
cagagaaatccccgcattacggcactcattttatcatcaccttgtctgggtctgcaaata
aaagtcaataaagtccttgattttgcgtctaaaggactgaacgtcctcgctccgtccctc
agagtggattccggtttatcacctgatatggcaacgaggaatgcggatatgattgaagcg
gatcaaaacgattctttatatgtcacgaaggtatccgtaagatggtacagagagctttta
aaaaccattgatgccgctatggtgccgactgatgcgtttttaaaggtgccgcttttgctt
atgcagggcggtgatgacaaaatcgtcgataaaatgaaggtccgcaaatggttttccggt
gtggcttcccataataaatcgtaccgggaatgggaagggctttatcatgaaatttttaat
gaaccggaaagagaaactgtgtttaaggcggcaaaagcctttacagatcagtatatttga

DBGET integrated database retrieval system