KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_14215Help
Entry
B938_14215        CDS       T02382                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B938_14215
Enzymes [BR:bamp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     B938_14215
Peptidases [BR:bamp01002]
 Cysteine Peptidases
  Family C44
   B938_14215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2927800..2929698)
Genome map
AA seq 632 aa AA seqDB search
MCGFVGVFNKHPLTQTADQEELIKQMNQMIVHRGPDSDGYYHDEHVGFGFRRLSIIDVEN
GGQPLSYEDEKYWIIFNGEIYNYIELREELEAKGYTFNTDSDTEVLLATYRHYKEEAASK
LRGMFAFLIWNKADRVMYGARDPFGIKPLYYTTIGDKVYFASERKSLMAAQNGIDLDTAS
LQQYMSFQFVPEPSTLDAEVKKVEPGSQFTIRPEGDIAFKTYFKANFKPVQSDEDKLVKE
VRDAIFDSVKVHMRSDVPVGSFLSGGIDSSFIVSVAKEFHPSLKTFSVGFEQQGFSEVDV
AKETAAALGIENISKVISPEEYMNELPKIVWHFDDPLADPAAIPLYFVAKEAKKHVTVAL
SGEGADELFGGYNIYREPLSLKPFERIPSGLKKMLLHVASVMPEGMRGKSLLVRGCTPLE
ERYIGNAKIFEEPVKKQLLKHYNPELSYRDVTKPYFTESRSYSDINKMQYVDIHTWMRGD
ILLKADKMTMANSLELRVPFLDKVVFDVASKIPDELKTKNGTTKYLLRKAAEGVVPDHVL
NRKKLGFPVPIRHWLKNEMNEWVRNIIRESETDAYIEKDYVLQLLEDHCADRADNSRKIW
TVLIFMIWHSINVEKRLVPEELNHQPKEVIFV
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtcggtgtttttaataagcatccattaactcaaaccgcagatcaagaa
gagctaatcaaacaaatgaaccaaatgatcgttcaccgcggtcctgacagcgatgggtat
tatcatgacgagcacgtcggattcggcttcagacggctcagtattattgacgtagaaaac
ggcggacagcctttatcatatgaagacgaaaaatattggatcatttttaacggcgaaatc
tataactacattgaattgagagaagagcttgaagcgaaaggctacactttcaatacagat
tccgataccgaagttctccttgcgacataccgtcattataaagaagaagctgcttcaaag
cttcgcggaatgtttgcgtttttaatctggaacaaagctgaccgcgtcatgtacggcgcg
agagacccgttcggaattaaaccgctgtattacacaaccatcggggacaaagtatatttt
gcatctgaaagaaaaagtttaatggccgctcaaaacggcattgatcttgatacagcttct
ttacagcaatatatgtctttccaattcgttcctgaaccgagcacgcttgacgctgaagtg
aaaaaagtcgagccgggcagccagtttacgatccgcccggaaggcgacatcgcgtttaaa
acatatttcaaagcgaactttaagcctgttcagtctgatgaagataaattggtgaaagaa
gtcagagacgcaatctttgactctgtcaaagttcacatgagaagtgacgttcctgtcggt
tcgtttctatccggcggtatcgactcttcttttatcgtctcagttgcgaaagaatttcac
ccgagcctcaaaacattttccgtcggttttgagcagcagggcttcagtgaggttgacgta
gcgaaggaaacggctgccgcgctcgggattgaaaacatcagcaaagtcatttctcctgag
gagtatatgaacgagcttccgaaaatcgtctggcactttgatgacccgcttgcagatccg
gcggcgattcctttgtactttgtcgcgaaagaagcgaaaaaacatgtaacggtcgcgtta
tccggggaaggcgcggacgagctgttcggcgggtacaatatttaccgcgaaccgctttcg
cttaaaccgtttgaacgcattccgtccggtctgaaaaaaatgcttcttcatgtggcgtcc
gtcatgcctgaaggaatgagagggaaaagcctcttagtccgcggctgcacaccgcttgag
gagcgttatatcggtaatgcgaagatttttgaagagcccgtgaaaaaacagctgctcaaa
cattacaatccagagctttcataccgtgatgtcacgaagccgtactttacggaaagccgt
tcatacagcgacattaataaaatgcagtatgttgacatccatacgtggatgcgcggcgac
atcctgttaaaggctgacaaaatgacgatggccaactctttggaactgcgcgtgccgttc
cttgataaagtcgtgtttgacgtggcttctaaaattccggatgaactgaaaacgaaaaac
ggcacgacgaaataccttctgcgcaaagctgctgaaggggtagtgcctgatcatgtgctt
aaccgcaaaaagctcggcttccctgtgccgatccgccactggctgaaaaatgaaatgaac
gaatgggttcgcaacatcattcgtgaaagtgaaacagatgcttatattgaaaaggattat
gtccttcagcttctggaagatcattgtgccgacagagcggacaacagccgcaaaatctgg
accgtcctgatcttcatgatctggcacagtatcaatgttgaaaaaagactggtgccggaa
gagctgaatcatcagccgaaagaagtcattttcgtttaa

DBGET integrated database retrieval system