KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_15035Help
Entry
B938_15035        CDS       T02382                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B938_15035
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B938_15035
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    B938_15035
Enzymes [BR:bamp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     B938_15035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3091643..3092701)
Genome map
AA seq 352 aa AA seqDB search
MWKGLIHQYKEFLPVTDQTPALTLHEGNTPLIHLPKLSEKLGIELHVKTEGVNPTGSFKD
RGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARAGMKCIVIIPDGKIAFGKLAQAVM
YGAEIIAIDGNFDDALAIVRSICEKSPIALVNSVNPYRIEGQKTAAFEVCEQLGEAPDIL
AIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGSAAIVRGEVIKNPETVATAIRI
GNPASWDKAVLAAEESAGKIDEVTDEDILHAYQLIAREEGVFAEPGSCASIAGVLKQVKS
GEIPKGSKVVAVLTGNGLKDPNTAVDVSDIKPITLPTDEDSILEYLNGAARV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggactcatccatcaatataaagaatttctgccggtgacggatcagacgccg
gccctgacattgcatgaaggcaacacgccgctgattcacctgccgaaactttccgaaaag
ctcggaattgaactgcatgtgaaaacagagggcgttaatccgacgggatcctttaaagac
cgcggcatggtcatggcggtcgccaaagcgaaagaagaaggcaatgataccatcatgtgc
gcctctacagggaacacatccgcggcagctgcggcatacgcggcgagagccggcatgaaa
tgcatcgtcatcatcccggacggaaaaatcgccttcggaaaacttgcgcaggccgtcatg
tacggtgcggaaatcatcgcgattgacggaaactttgacgacgcgctggccatcgtccgg
tcgatttgcgaaaaatcaccgattgcattagtgaattcagtaaacccttaccggattgaa
gggcaaaaaacagcggcctttgaagtatgcgaacagctcggcgaagcgccggacattctg
gcgatcccggtaggaaacgccgggaatatcacggcctactggaaaggattcaaagaatac
catgagaaaaacggcaccggacttccgaagatgcgcggttttgaggcggaaggttctgcg
gctatcgtccgcggcgaagtcattaaaaatccagagaccgttgcgacggcaatccgaatc
gggaatcctgccagctgggacaaagcggtgctcgctgcggaagaatcagccggaaaaatt
gatgaagtcacagatgaagacattcttcacgcttatcagctgattgcccgtgaagaaggc
gtgtttgccgaaccgggctcctgtgcatccattgccggcgttttgaaacaggtaaaatcc
ggtgaaattccaaaaggcagcaaggttgtcgcagttttgaccggaaacggcctgaaagat
ccgaacacggctgtagacgtatctgacataaaaccgattacgctgccgacagatgaggac
agtattctggaatacttaaatggagcggcgcgtgtatga

DBGET integrated database retrieval system