KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_15835Help
Entry
B938_15835        CDS       T02382                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3239909..3240649)
Genome map
AA seq 246 aa AA seqDB search
MKIVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYKGHGVPPEEL
VHTGPEDWWKDVMDGYEYLRSEGYENIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMHI
KSEEVMYEGVLSYARNYKKFEGKQPEQIEKEMKEFEKTPMNTLKSLQELIADVRKNVDMI
YSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVYEF
LEKLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtgcttctg
ctgcacggatttacgggaaatacggcagacgtcagaatgctcggccgctacttgaatgag
cgcggctacacttgtcacgcgcctcaatataaagggcacggcgttccgccggaagagctg
gtacatacggggcctgaagattggtggaaagacgtcatggacggttatgaatatttacgg
tctgaaggctatgaaaacattgcggcctgcggactgtcgcttggcggggttttttcattg
aaattgggttacactgtacccataaagggaattgttcctatgtgtgcgccgatgcacatt
aaaagtgaagaggttatgtacgaaggagttctctcctacgcgcgcaattataaaaaattc
gaaggaaaacagccggagcagattgaaaaggaaatgaaggagtttgaaaaaacaccgatg
aatacgctcaaatcgcttcaggagctgattgccgatgtgcgcaaaaacgtcgacatgatc
tattccccgacatttgtggttcaggcacggcatgaccatatgattaatacagaaagtgcg
aacatcatttacaacgaggtggaaacggacgacaaacagctgaaatggtatgaagaatca
ggtcatgtcattacgctcgataaagaacgggacctcgttcatcaggatgtgtacgaattt
ttagagaaactcgattggtaa

DBGET integrated database retrieval system