KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_16850Help
Entry
B938_16850        CDS       T02382                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B938_16850
   00052 Galactose metabolism
    B938_16850
   00500 Starch and sucrose metabolism
    B938_16850
   00520 Amino sugar and nucleotide sugar metabolism
    B938_16850
Enzymes [BR:bamp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     B938_16850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3437559..3438437
Genome map
AA seq 292 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKS
KRAIEDHFDYSPELERNLEEKGKVELLEKVRKASNLADIHYIRQKEPKGLGHAVWCARNF
IGDEPFAVLLGDDIVQAEKPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTSEG
RRYQVKNFVEKPAQGTAPSNLAILGRYVFTPEIFMYLEEQQIGAGGEIQLTDAIQKLNEI
QRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDRELRDHLIPFMEDLLRKDEL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaagtacgcaaagccataattcccgctgcaggtttagggacacgctttctgccg
gcaacaaaagccatgccgaaagagatgcttccgattgtagacaaaccaacgattcaatac
ataattgaagaagcggttgaagcgggtattgaagacattattattgttacgggaaaaagc
aagagagccattgaagaccattttgattactcaccagagctggaaagaaacctagaagaa
aaagggaaggtcgaactcttagaaaaagtccgaaaagcctctaatcttgctgacattcat
tatatccggcaaaaggagccaaaaggtcttggacatgccgtttggtgcgcacgtaatttt
atcggtgacgagccatttgccgtccttctcggagatgatatcgttcaagctgaaaaacca
gggcttcgccagctgatggatgaatatgaaaaaacactttcttccattataggggttcag
caagtgcctgaagaagaaacccatcgttacggaattattgatccgctgacaagtgaaggc
cgcagatatcaggtgaagaactttgttgagaagccggctcaagggactgctccgtccaat
ctggcaatactgggacgttatgtcttcactcctgaaatcttcatgtatcttgaagaacag
caaattggtgccggaggagaaattcagcttacagacgctattcaaaagctgaatgaaatc
cagcgggtttttgcttacgattttgagggcaaaagatatgatgttggtgaaaaactaggt
tttattaccactacattagaatttgcgatgcaggatcgtgaactgcgtgatcaccttatc
cctttcatggaagacctgttaagaaaagatgaattataa

DBGET integrated database retrieval system