KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_17005Help
Entry
B938_17005        CDS       T02382                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B938_17005
Enzymes [BR:bamp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     B938_17005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3471755..3472636
Genome map
AA seq 293 aa AA seqDB search
MSEICVIGSCSMDLVVTSERRPKVGETVLGTDFQTVPGGKGANQAVAASRLGANVYMVGK
AGNDSYGKAIIENLKANGVNTDHMETVTHKKSGTAHIVLAEGDNSIVVVKGANDDISPDY
AKSALAKLPGIDIVLIQQEIPEETVEAVCSYCRAQQIPVILNPAPARPLKQSTIEDAAYL
TPNEHEASILFPDRTKEEALAGYPGKLFITEGKQGVRYSDGTAERLVPAFPAEAVDTTGA
GDTFNAALAVALAEGRDIEQALLFANRAASLSVQHFGAQGGMPARKEVEELLS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatttgtgttatcggaagctgttctatggatctggtcgtcacatctgaacgg
cggccgaaagtcggagaaaccgtactgggcacagactttcaaaccgtgcccggaggaaaa
ggcgcaaatcaggccgtagccgcttcccgcctaggcgcaaacgtatatatggtaggaaaa
gcaggcaatgacagctacggaaaagcgattattgaaaacctgaaggcaaacggtgtcaat
acggaccatatggaaacggttacacataaaaaaagcggaacggctcatattgtgctcgca
gaaggagacaacagcatcgtcgtcgtaaaaggcgcaaacgatgacatctcccccgattat
gccaaaagtgcgctagcaaaacttcccggcattgatatcgtgctgatccagcaggagatt
cctgaagaaaccgttgaagcagtgtgcagctactgccgcgcgcagcaaattccggttatc
ctgaatcccgcgccggcccggccgctgaaacaatcgacgattgaggatgccgcatatctt
acgccgaacgaacatgaagcatccattttatttcctgaccggacgaaagaagaagcgctc
gccggctatcccggcaaactgttcattaccgaaggaaaacaaggcgtgcgctactcagac
ggcaccgcggaacggcttgttcccgccttccctgcagaagcggtcgacacgacgggagcc
ggcgatacctttaatgcggcacttgccgtcgcactcgcggaaggacgggacattgagcaa
gcgctcctgtttgccaaccgcgccgcctccctgtccgtgcagcacttcggcgcccaaggc
gggatgccggccagaaaagaagttgaggagctgctgtcatga

DBGET integrated database retrieval system