KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_17340Help
Entry
B938_17340        CDS       T02382                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3529714..3530355
Genome map
AA seq 213 aa AA seqDB search
MFKFKKKFLVGLTAAFMSISMFSATASAAGTDYWQNWTDGGGTVNAVNGSGGNYSVNWSN
TGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRAPLIEYYVVDSWGTYRPTG
TYKGTVKSDGGTYDIYTTTRYNAPSIDGDNTTFTQYWSVRQSKRPTGSNAAITFSNHVNA
WKSHGMNLGSNWAYQVLATEGYKSSGSSNVTVW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtttaaaaagaaattcttagttggattaacggcagctttcatgagtatcagc
atgttttcggcaaccgcctctgcagctggcacagattactggcaaaattggacagatggg
ggcggaacagtcaacgcagtcaatggatctggcgggaattacagtgttaattggtctaat
accggaaatttcgttgttggtaaaggctggactacaggctcgccatttagaacaataaac
tataatgccggagtctgggcgccgaatggcaatggatatttgactttatatggctggacg
agagcacctctcatcgaatattatgtagtggattcatggggtacttacagacctaccgga
acgtataaaggtactgtaaagagtgatggaggtacatatgacatatatacaacaacacgt
tataacgcaccttccatcgatggcgataacactacttttacgcagtactggagtgttcgc
cagtcgaagagaccgaccggaagcaacgctgcaatcactttcagcaatcatgttaacgca
tggaagagccatggaatgaatctgggcagtaattgggcttatcaagtcttagcgacagaa
ggatataaaagcagcggaagttctaatgtaacagtgtggtaa

DBGET integrated database retrieval system