KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_18660Help
Entry
B938_18660        CDS       T02382                                 

Definition
BglH
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B938_18660
Enzymes [BR:bamp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     B938_18660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3779071..3780468)
Genome map
AA seq 465 aa AA seqDB search
MKRFPEGFLWGGATAANQIEGAYKEGGKGLSTADVSPDGIMSPFHETDDALNLYHDAIDF
YHRYQEDIALFAEMGFKAFRTSIAWTRIFPNGDETEPNEEGLQFYDRLFDELRKHQIEPV
VTISHYEMPLGLVKNYGGWRNRRTVDFYERYARTVFTRYKDKVKYWMTFNEINVVLHAPF
TGGGLIFREGENKQNTMYQAAHHQFVASALAVKAGHEIIPDSQIGCMIAATTTYPMTPKP
EDVYAALQKERSTLFFSDVQARGSYPGYMKRFFKENGITIEMKEGDEALLKEHTVDYIGF
SYYMSMTASTAPEDLAQSKGNLLGGVKNPYLKSSEWGWQIDPKGLRITLNTLYDRYQKPL
FIVENGLGAVDQPEEDGTIQDDYRINYLRDHLIEAREAIEDGVDLIGYTSWGPIDLVSAS
TAEMKKRYGYIYVDRGNDGKGTFERKKKKSFYWYKDVIATNGESL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaagagatttccggaaggttttttatggggcggcgcaacggctgccaatcagattgaa
ggagcttataaagaaggaggcaaaggactttctacggcggatgtctccccggacggcatt
atgtctccgtttcatgagacagacgatgcgctgaatttgtatcacgacgcgattgatttt
tatcaccgctatcaagaggatatcgccctgtttgcggagatgggctttaaagcgttccgc
acctccattgcgtggacgagaatctttccgaacggtgatgaaacagaaccgaatgaagaa
gggctgcaattttacgaccgtttgtttgacgaattgagaaaacatcagatagaaccggtc
gtcacgatttctcactatgagatgccgctcggtcttgtgaaaaactacggcggctggaga
aaccgccggacggtcgatttctatgagcggtacgcccgcacggttttcacccgttataaa
gacaaggtgaaatattggatgaccttcaatgagatcaacgtcgttcttcacgctccgttt
acaggcggcggccttatattccgggaaggcgaaaataaacaaaacacgatgtaccaagcg
gcccaccatcaatttgtggcgagcgcgctggcggtaaaagcaggccatgagatcatcccg
gattcacagatcggctgcatgatcgccgcgacgacgacgtatccgatgacgccgaagccg
gaggatgtatatgcggctttgcaaaaagagcggagcacgctgttcttttctgatgtacag
gcgaggggcagctatccgggctatatgaaacgcttctttaaagaaaacggaattacgatc
gagatgaaggaaggagacgaggcgctcctgaaagaacatacggtggattacatcggcttc
agctactacatgtcgatgacggccagcacggcgcctgaggatctggcgcaatctaaggga
aatcttctcggcggcgtgaaaaacccgtacctgaaatcttccgaatggggctggcagatt
gatccgaagggcttgcgcatcaccttaaacacgctgtacgaccgttatcagaaaccgctc
ttcatcgtcgaaaacggactcggcgcggttgatcagccggaggaggacggaaccattcag
gatgactaccgcatcaattatctgcgtgatcatttaatagaggcaagagaagcgattgaa
gacggcgtcgacctgatcggctacacgtcgtgggggccgattgacctcgtcagcgcctca
acggcagaaatgaaaaaacgctacggctatatctatgtcgaccgcggcaatgacggaaaa
ggcacgtttgaaagaaagaaaaagaaaagtttttattggtataaagacgtcatcgccaca
aacggagaaagtctgtaa

DBGET integrated database retrieval system