KEGG   Bacillus amyloliquefaciens subsp. plantarum AS43.3: B938_19090Help
Entry
B938_19090        CDS       T02382                                 

Definition
(RefSeq) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
bamp  Bacillus amyloliquefaciens subsp. plantarum AS43.3
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bamp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B938_19090
  Amino acid metabolism
   00220 Arginine biosynthesis
    B938_19090
   00330 Arginine and proline metabolism
    B938_19090
Enzymes [BR:bamp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     B938_19090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3874509..3875399)
Genome map
AA seq 296 aa AA seqDB search
MNKNISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYAVEDLGDIPVNREKLKND
EELKNLNSVLSGNEQLAQKVDSVIENERFPLVLGGDHSIAIGTLTGTAKHYKQLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGVGHDTLVNLGGYAPKIKPENVVIIGARSLDEGER
EYIKETGMKVYTMHEIDRLGMTKVIEETIDYLSDCDGVHLSLDLDGLDPSDAPGVGTPVV
GGISYRESHLAMEMLYDADIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaatatctcagttattggaatgccgatggatttaggacaagcacgacgcgga
gtggacatgggcccgagcgctatccgctacgcgcatctcattgaacggttatctgacatg
gggtatgcggtggaagacttaggcgacatcccagtcaatcgtgaaaaactcaaaaatgat
gaagagctgaaaaatctgaactctgtgctctcggggaacgagcagctcgcccaaaaggtg
gacagcgtcattgagaatgagcggttccctctcgtcttgggcggcgatcacagcatcgcg
atcggaacgctgacaggaacggcaaagcactataaacagctcggcgtcatctggtacgac
gcgcacggcgacttaaacaccctggaaacatcgccgtcaggcaatattcacggaatgccg
ctggccgtcagcctcggcgtcgggcacgacacgctggtgaatctgggcgggtatgccccg
aaaatcaagccggagaacgtcgtcatcatcggcgcgagatcgcttgatgaaggcgagcgt
gagtacattaaggaaacaggcatgaaggtctatacgatgcatgagattgaccgcctcggc
atgacaaaggtcattgaagaaaccattgactacttgtcagactgtgacggcgttcacctc
agccttgacctcgacggccttgatccgagcgacgcgcccggcgtaggcacacctgtcgtc
ggcggcatcagctaccgtgaaagccacttggcaatggagatgctgtatgatgccgacatc
atcacttcagctgaatttgtcgaagtcaacccgatcctcgatcacaaaaacaaaaccggc
aaaacagcggtcgagctggtggaatctttgttaggaaaaaaactattataa

DBGET integrated database retrieval system