KEGG   Bacillus anthracis Ames: BA_0021Help
Entry
BA_0021           CDS       T00129                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ban  Bacillus anthracis Ames
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ban03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
27567..28163
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVC
GHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGGIGPE
DINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccaatatcaaaactaattgatagttttatgaaattgccaggaatc
ggaccgaaaacagcggttcgattggcatttttcgtattagatatgaaagaagatgatgtg
ttaggttttgcaaaagcacttgtaaatgcaaagcgagacttagcgtattgttccgtatgt
gggcatattactgaccgtgacccttgttatatttgtaacgattcacatcgagatcaatca
gtggtttgtgtcgtacaagaaccgaaagatgtaatcgcgatggaaaagatgaaagagtat
caaggtgtatatcatgtgttacgtggtgctatctctccaatggggggaattggaccagaa
gacattaatatcccgcagcttttaaagcgactgcacgatgaaacggtacaagaagtaata
ttagcaacaaatcctaatattgaaggggaagctacagcgatgtatatatcccgcctctta
aagccgacaggtattaaagtaactcgtattgcacatggtctgccggttggtggagattta
gaatatgcagatgaagtgacactgtcgaaagcgttagaaggtcgtagagaagtataa

DBGET integrated database retrieval system