KEGG   Bacillus anthracis Ames: BA_0499Help
Entry
BA_0499           CDS       T00129                                 

Gene name
glsA-1
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ban  Bacillus anthracis Ames
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BA_0499 (glsA-1)
   00330 Arginine and proline metabolism
    BA_0499 (glsA-1)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BA_0499 (glsA-1)
Enzymes [BR:ban01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BA_0499 (glsA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
complement(492962..493891)
Genome map
AA seq 309 aa AA seqDB search
MQCIETNNLQQLLEQVKPYTKKGKLATYIPELGNANPDDLGIAIFHKETEYIHAGNSQTL
FTLQSISKVITLALALLDRGEEYVFSKVGMEPTGDPFNSIIKLETTSPSKPLNPMINAGA
LAITSMLAGKDNEEKMERILHFVREITDNPTINYSSKVANSELETAYLNRSLCYYMKQNG
IIDCDIEELMDLYTRQCAVEVNCIDLARIGLIFAMDGYDPYKKKQIIPKHITKICKTFMV
TCGMYNESGEFAIRVGIPAKSGVAGGIFGCVKGEMGIGIFGPALDANGNSIAGFKILELL
SAQEGWSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcattgaaacaaacaacttacaacagttgttagaacaagtaaaaccatatacg
aaaaaaggaaagcttgctacttatatccccgaactaggaaatgccaatccagatgattta
gggattgccattttccataaagaaacagaatacatccatgctggcaactcacaaacacta
ttcactcttcaaagtatttcaaaagtaattacacttgcacttgcacttttagatcgtggt
gaagaatatgtattttctaaagttggaatggagccaactggtgatccatttaattctatt
attaagttagaaacgacgagtccttctaaaccacttaatccaatgattaatgcaggggca
ctagctattacaagtatgttagcaggaaaagataacgaagaaaaaatggagcgcattctt
catttcgtacgtgaaataacagataatcctactattaattattcttctaaagttgccaat
tcagaattagagacagcttacttaaatcgttcactttgttactatatgaaacaaaacgga
attatcgattgtgatatcgaagaactgatggatttatacactcgccaatgtgcagttgaa
gtaaactgtattgatttagcacgtatcggtttaatttttgcgatggatggatatgatcca
tataagaaaaaacaaattatccctaagcatattacaaagatttgtaaaacatttatggtt
acatgtggtatgtataacgagtctggtgaatttgcgattcgtgttggtatcccagcaaaa
agtggtgtagctggtggtattttcggctgcgtaaaaggagaaatgggaattggtattttc
ggaccagctttagatgcaaacggaaatagtatcgctggttttaaaattcttgaacttctt
tctgctcaagaaggttggagcattttttaa

DBGET integrated database retrieval system