KEGG   Bacillus anthracis Ames: BA_1072Help
Entry
BA_1072           CDS       T00129                                 

Gene name
hemY-1
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ban  Bacillus anthracis Ames
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BA_1072 (hemY-1)
Enzymes [BR:ban01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BA_1072 (hemY-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1053190..1054611
Genome map
AA seq 473 aa AA seqDB search
MRKKVVIIGGGITGLTTMYHLQKDIRDKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERG
PDSFLARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPSGSMMGIPTQITPFLF
SGLFSPIGKLRAGFDLLMPRSKPVSDQSLGHFFRHRLGNEVVENLIEPLLSGIYAGDIDE
MSLMSTFPQMYQIEQKHRSISLGMRTLAPKAEKAEPKKGIFQTVKTGLESIVESLELKMH
EGTIIKGTRIEKVAKQGDGYAITLSNGKEIEADAVVVASSHKVLPSMFAQYKQFRFFRNI
PSTSVANVAMAFPKSAIQRDIDGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCY
VGRPGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTVVSRWKEAMPQYTVGHNERMKK
LTTFMEKELPGIYLAGSSYAGSGLPDCIDQGEKAAKRVLSHLEKVMNTELIAQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaaaaaagttgtaatcatcggcggtggcatcacaggattaacaacaatgtatcac
ttacaaaaagatattcgtgacaagaacttgccgatcgatacattactgatagaagcatcg
ggtaaacttggcgggaaaattcaaaccgttcgaaaagatggatttacaattgaacgcgga
ccggattctttcttagcacgaaaagaaagtgcagctagattagtgaaagaattaggtctt
ggcgatgagcttgtaaataatcaggccggtcaatcatttatcctcgtaaacaatcggtta
cataaaatgccgagcggatcaatgatgggaattccaacgcaaattacgccgtttctattt
tctgggctgttctccccaattgggaaactaagagctggttttgatctattaatgccaaga
tcaaaaccagtatctgaccaatcactcgggcactttttcagacatcgcctcggaaatgaa
gtggttgaaaatttaatagaaccattactatctggtatttatgcaggggatattgatgaa
atgagcttaatgtcaacattcccgcaaatgtatcaaattgagcagaaacatcgcagtatt
tcactcggtatgcgtacgctcgccccgaaagcagagaaagctgaaccgaaaaagggaatc
ttccaaacagtgaaaaccggtttagaatctatcgtagaatctctcgaattaaagatgcat
gaaggtacgataataaagggaactcgcatagaaaaagttgcaaaacagggtgatggctat
gcgattactcttagtaacggaaaagaaatagaagcggacgcggtcgtagtggcaagctca
cataaagtattgccatctatgtttgcgcagtacaagcaatttcgtttcttccgcaacatt
ccatccacatcagttgcgaatgtggcaatggctttcccgaaatcagccattcagcgggat
attgatggtacaggatttgttgtctctcgaaatagtgattacacaattacagcatgtacg
tggacgcataaaaagtggccacatacaacgccagaaggaaaaacgcttcttcgatgttac
gttggacgacctggtgatgaagcggttgtagaacaaacagaagaggaactcgttcagctc
gtactagaagacttacgaaagacgatggatattacagaggatccagagtttacagtcgta
agtcgctggaaagaagcaatgccccaatatacagtaggccataacgagcgaatgaagaaa
ctcacaacatttatggagaaagagttgccaggtatatacttggcaggtagttcttacgct
ggttctggtcttccggactgtattgatcaaggtgagaaggctgcaaaacgtgtactctct
catttggagaaagtaatgaatacggaattaatcgcacaataa

DBGET integrated database retrieval system