KEGG   Bacillus anthracis Ames: BA_1132Help
Entry
BA_1132           CDS       T00129                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00630  Glyoxylate and dicarboxylate metabolism
ban01100  Metabolic pathways
ban01110  Biosynthesis of secondary metabolites
ban01120  Microbial metabolism in diverse environments
ban01200  Carbon metabolism
Module
ban_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BA_1132 (aceA)
Enzymes [BR:ban01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BA_1132 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 1089079
NCBI-ProteinID: NP_843617
Position
1106290..1107567
Genome map
AA seq 425 aa AA seqDB search
MKNERIEKLQESWELDTRWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWASLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGSGDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
KAFITGERTPEGFYRTKAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIHKEH
PGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGY
KERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
AQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaatcgagaaattacaagagagctgggaattagatacgcgttggaaa
gggattacacgtccatattcggcagaagatgtaattcgcctgcgcggatcaattgatatc
gagcatacattagcgcgccgcggtgctgaaaagctttgggcatcgcttcatacagaagat
tacattaacgcacttggggcattaacaggaaaccaagcgatgcaacaagtaaaagctggg
ttaaaagcaatttatttaagtggatggcaagtagcggccgatgcaaacctgtctggacat
atgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtcgtaaaacgaatt
aatcaaacacttcaacgtgcggatcaaattcagcatatggaaggaagcggtgatacagat
tatttcgtgccaattgtagcagatgcagaagctggatttggcggacaattaaacgtattt
gaactgatgaaaggtatgattgaagcgggtgcgtctggcgtgcactttgaagatcaatta
tcttcagagaagaaatgcggtcatttaggcggaaaagtattactaccaacgcaaacagca
gtgcgtaatttaatttcggcacgccttgctgcagacgtaatgggagtgccgacaattatc
gttgcaagaacagatgcggatgcagcagatttaattacgagcgatatcgatcctgttgat
aaagcgtttattacaggagaaagaacaccagaaggattttaccgtacgaaagcaggtctt
gaccaagcgattgcacgtggtttagcgtacgctccttacgcagacctcgtttggtgtgaa
acttcagaaccaaatttagaagatgcaaaacgatttgcggacgcaattcataaggagcat
ccagggaagctacttgcatataactgctcaccttcattcaactggaaacaaaaactagat
gaaaaaacaattgcaagcttccaaaaggaaatcgcatcttacggttacaagttccaattc
gtaacacttgctggattccattcattaaattacggtatgtttgaactagcacgtggctat
aaagagcgcggcatggcagcatactctgaactacaacaagcagaattcgcagctgaaaaa
cacggctactctgcaacacgtcatcaacgcgaagtaggaacaggttactttgatgaagtg
gcacaagtgattacaggcggaacttcatcaacgacagcgttaaaaggatctacagaagaa
gcacagtttacgaaataa

DBGET integrated database retrieval system