KEGG   Bacillus anthracis Ames: BA_1157Help
Entry
BA_1157           CDS       T00129                                 

Gene name
asnO-1
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ban  Bacillus anthracis Ames
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ban00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1126104..1127951
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVDYKRSLEGERDVVTKMAETLAKRGPDDNKVWIKGNVAFGHKRLIVVDPEGGK
QPMTCLKDEANYAICYNGELYNTEDIRKELLRRGYTFKGHSDTEVLLASYIEWKEECVDH
LNGIYAFAVWDEQKEQVFIARDRLGVKPLFYKYDSGRLLFGSELKAILAHPDVKAEVTLE
GLSEIFGLGPSRTPGHGIYTGIKELRPGHAMTFSKNGLCIWRYWNVESKKHEDSFEETVE
KTRFLLQDAITRQLVSDVPLCTFLSGGVDSSAITAIAAKEYEKSGKGQLHTYSVDYEDND
KYFKANAFQPNSDAPFIHLMTETFQTIHHRCVISNEQLAQYLTEAVLVRDLPGMADIDSS
LLWFCREIKQDFVVGLSGECADEIFGGYPWFYREDDLQSSAFPWMRSTEAREQLLKKEWR
NKLNLQQYVQQRYEESIQEVPILDGESPLEAKRRQLFYLNMVWFMTTLLDRKDRMSMGAS
LEVRVPFADHRLVEYAWNIPWEMKMYKNREKGLLRKALEGLLPNDILYRKKSPYPKTHNP
HYTKAVTVWIQDLLTDKGSILHELFDKEQLSGLIESGGSAFQTPWYGQLMTGPQLLAHLA
QIHVWFKEYGVNIKE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggattacaggatgggtggattataaacgctcattagaaggagaacgggacgtc
gttacgaagatggctgagacgttagcgaagcgtggtccagatgataataaagtttggatt
aaaggcaatgtcgcatttgggcataaacggttaatcgttgttgatcctgaaggtggtaaa
cagccgatgacttgtttaaaggatgaagcaaattatgcaatttgctataacggcgaactg
tataacacggaagacattcgaaaggaactattaagaagaggatatacgttcaaaggtcac
tctgatacggaagtattgttagcttcttatatcgaatggaaagaagaatgtgtcgatcat
ttaaacggtatatatgcgtttgctgtatgggatgaacagaaagaacaagtgtttattgcg
cgcgatcgattaggggtaaaaccactattttataaatatgacagtgggcgattactattt
ggctcagagttaaaagcgatattggcgcatccagatgtgaaggcggaagtgacgttagaa
ggattatctgaaatatttggccttggaccatctagaacgcctggtcacggtatttatact
ggcataaaagaattacgtccaggtcatgcgatgacattttcgaagaacggtttatgtata
tggagatattggaatgtagaaagtaaaaagcatgaagattcttttgaagaaacagtagaa
aaaacacgctttttattacaagatgcgattacaaggcagctcgtttctgatgtaccatta
tgcacttttttatcaggcggtgtagattcaagcgctataacagcaattgctgcgaaagaa
tacgaaaaatcgggaaaaggtcaattacacacgtattcggttgattacgaagataatgac
aaatactttaaagcaaatgcgtttcagccaaattcagatgcaccatttattcatttgatg
actgagacgtttcaaacgatccatcatcgttgcgtcatttcaaatgaacaattagcgcag
tatttaacagaagcagtactcgttcgtgatttgcctggtatggcagatattgattcgtca
ttattatggttttgtcgtgaaattaaacaagattttgtcgttggtttatctggggaatgt
gcagatgaaatatttggtggttatccatggttttatagagaagatgatttacaatcgagt
gcatttccgtggatgcgttctacagaagcgcgtgaacaattgctaaagaaagaatggaga
aataaattaaatttacaacaatatgtacagcagcgctatgaagaatccattcaagaagtt
cctattttagatggggaaagtccgctagaagcaaaaagacgccaattattttatttaaat
atggtatggtttatgacaacattattagacagaaaagaccgcatgagtatgggggcaagc
ttagaagtgcgcgttccatttgcagatcaccgacttgtcgaatatgcgtggaatattcct
tgggaaatgaaaatgtataaaaaccgcgaaaaaggtctattgcgtaaagcgttagaaggg
ttacttccaaatgacatcttatatagaaagaagagcccgtatccaaaaacacataatccg
cactatacgaaagcagtaacagtatggatacaagatttattaacggataaaggctcaatt
ttacacgagctatttgataaagaacagctgagtggattaattgagtcaggcggcagtgca
ttccaaacgccatggtatggtcaattaatgactgggccacagcttttagctcatttagca
caaattcatgtttggtttaaagaatatggagtaaatattaaagaatag

DBGET integrated database retrieval system