KEGG   Bacillus anthracis Ames: BA_1251Help
Entry
BA_1251           CDS       T00129                                 

Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ban01100  Metabolic pathways
ban01110  Biosynthesis of secondary metabolites
ban01130  Biosynthesis of antibiotics
ban01230  Biosynthesis of amino acids
Module
ban_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BA_1251
Enzymes [BR:ban01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BA_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh His_biosynth
Motif
Other DBs
NCBI-GeneID: 1085544
NCBI-ProteinID: NP_843723
UniProt: Q81TM0
Position
1206078..1206839
Genome map
AA seq 253 aa AA seqDB search
MGTILDKIVNQKKKEVAALYETYTPVKEKRKTRSLVKALEQFTVIAEVKRASPSKGDINL
HVDVRKQVKTYEECGAGAVSVLTDGQFFKGSFYDLQTAREESSIPLLCKDFIIDKIQIDR
AYEAGADIILLIVAALTKEKLKELYSYVLEKGLEAIVEVHDEQELEIAIQLNPHVIGINN
RNLKTFEVDLSQTEKLGKRLNEEKLLWISESGIHSKEDIIRVKRAGAKGVLVGEALMTSS
SIHTFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggggacgattttagacaaaattgtaaatcaaaagaaaaaggaagttgcggcattatat
gaaacatatacaccagtaaaagaaaaaagaaaaacgcgctcacttgtaaaggctctagag
caatttactgtcatcgcagaagtaaagcgagcatcaccatcaaaaggagatattaattta
cacgttgatgtacgaaaacaagtgaagacatatgaagaatgcggcgctggtgcagtttct
gttttaacagacggtcaattttttaaagggtcattttatgatttacaaacggcaagagaa
gaaagtagcattccgcttttatgtaaagatttcataatcgataagattcaaattgataga
gcgtatgaagctggtgcagatattattttactaatcgtagcggcgttaacgaaagagaaa
ttaaaagagttgtatagctacgtactagaaaaaggattagaagcgattgttgaagttcat
gatgaacaggaattagaaattgcaattcaattaaatccgcacgttatcggtattaacaac
cgtaatttaaaaacattcgaagtcgatttaagtcaaacagaaaagcttggaaaacgatta
aatgaggagaaattactttggattagtgagagcgggattcattcaaaagaagacataatc
cgcgttaaacgagctggggcaaaaggtgtattagttggagaagcgcttatgacatcgtct
tctattcataccttttttgaagattgtaaggtgaacatatga

DBGET integrated database retrieval system